KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7643Help
Entry
Dmel_CG7643       CDS       T00030                                 

Gene name
ald
Definition
altered disjunction (EC:2.7.11.-)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:90C1-90C1; 3R:3-61 cM
AA seq 672 aa AA seqDB search
MTTPVPRRTKDMMALGLDSDSEDDFNTPYRPRQAAAGERKQQPVASFQVQTRGKENEPHP
LPINMLPRRVSELTMMDSDSDEEDIKSNHNLNCAILNDSFVLSPSQELTNSNSNITTRRT
PSAAPLKQSDSNLSFLGRFNDMGINCSSQGSPVANSEKQVAKKTAPTLQAAPSATERRPL
QETETPLRNELPSTSKTKPDADFITPQVRTIGSTLAGKSRSAVSNDFRAQKVLFQTPMTV
SRAAPVASDSISFSLCDTITESPDIPEPPKKAEPPKSQHPSKKSLDHVFRESDKDNVPDK
VDNVEPKELVSIPAVAVPPEQPSHKTSNILKIKNHEYTIDKKLGCGGSSSVFLARRSDSG
NEFALKVVDLQADPQVVQGYLNETKLLAKLQGNVCVVALYDYQLVREESKLYMVMEKGDC
DLNKILQSYTTNLPLYSLMNILYQMLQAVNYIHQHGVIHSDLKPANFLMVSGRLKLIDFG
IASNIAVDSTSIIKFSQAGTFNYISPEALTDTSTGNSPMRRADQPKIKISTKSDVWSLGC
ILYLLLYQKTPFGHIRNVYAKMSAITTPGTSIEYPAIPPYYPIMLVHFTTVSALFADGQE
LPTVESQKAAVVHRTTTVPIPYDHSAAEPADTQQNRQQQLSTKAQLFISEMSKVKCLSHM
CVYIFNSHFIVN
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcctgtgccccgccgcaccaaggacatgatggcactgggactggactccgac
tccgaggacgactttaacacgccataccgaccacgacaagcggcggcgggagaacgaaaa
cagcagccggtggcgtctttccaagtccaaacgaggggcaaggagaacgaaccgcatccc
ctgcccataaatatgctacctcgccgagtgtccgagttgactatgatggattcggacagt
gacgaggaggacatcaagagcaatcacaaccttaactgcgccatcctaaacgattccttt
gtgctgagcccatcccaagagttaacaaacagcaacagcaacataaccactcgtagaaca
ccaagtgccgccccccttaagcaatccgattcgaatctctcgttcctgggaagattcaac
gacatgggcatcaattgcagcagtcaaggatcccctgttgcgaattcggaaaaacaggtg
gccaaaaagacagcacccacgcttcaagctgcaccaagtgccaccgaaaggcgcccactc
caagagacagagacgccactgcgtaatgaattaccctccacctcgaagacgaagccggat
gcagacttcattaccccccaagtacgaacaattggttccacactggcgggaaaaagtcgg
agtgcggtgtccaatgacttccgtgcgcagaaagtgctcttccaaacacctatgaccgtg
agtcgtgctgctccagtggcctccgatagcataagcttctccctgtgcgacaccatcaca
gaaagcccggacattccggagcctccgaaaaaggcagaaccaccaaagagtcagcatcct
tccaaaaagtccctagatcatgttttccgggagtcggacaaggataacgtgccagacaaa
gtggataatgtggaaccaaaggagctggtatcgattcccgcagttgctgtacctccagag
cagccttcccacaagacatctaatattttaaaaatcaagaatcatgagtatacgattgat
aagaaactgggctgtggcggctccagctctgtttttttggcacgccgatcggattccgga
aatgagttcgccctgaaggtggtggatctgcaggccgatccacaagtggtgcagggatat
ctaaacgaaaccaaacttctggcaaagctacaagggaacgtttgtgttgtggcactttac
gattatcaacttgtgcgcgaggagtccaagctgtacatggtgatggagaaaggtgactgc
gacttgaacaagatcctgcagagctacaccaccaaccttcctctctatagcctgatgaac
atcctgtaccaaatgctgcaagcggtcaactacattcaccaacacggtgtcatccattcg
gatctcaagccggcaaatttcctgatggtcagcggcagactgaagttgatcgattttggc
atagccagcaatatcgctgtggactcgacgagcatcatcaaattctcgcaggcgggcacc
tttaactacattagtccggaggcgttgacggacacctccacggggaatagcccgatgcgc
agagccgatcagccgaagatcaagatctcgaccaaatcggacgtgtggtcgctgggctgc
atcctttacctgctactctaccaaaagacaccgttcggccacatccgaaacgtctatgcc
aagatgagtgcaatcaccacaccgggcaccagcatcgagtatcctgccattccgccctac
tatcccatcatgctggttcattttacaactgtctctgctctatttgcagatggccaagaa
ctgcctacagttgaatcccaaaaagcggccgtcgtgcaccgaactactacagtacccatt
ccatatgatcattccgctgcagaacctgcagatacccagcagaaccgccaacagcaatta
agcacgaaagctcagctatttattagtgaaatgtcaaaggtcaaatgtctttctcatatg
tgtgtgtatatatttaattctcattttatcgtaaattaa

DBGET integrated database retrieval system