KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7789Help
Entry
Dmel_CG7789       CDS       T00030                                 

Definition
CG7789 gene product from transcript CG7789-RA (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dmel_CG7789
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dmel_CG7789
Transfer RNA biogenesis [BR:dme03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dmel_CG7789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:99C1-99C1
AA seq 306 aa AA seqDB search
MAATAPVIMRVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIAS
LAKKFPTVKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDG
TAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAVP
APAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKIPAEVR
AAVGAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaactgctccggtaattatgcgcgtcatggcgtcctcgatcagcaccgccaag
cgggctggcggcatcatacgcgacgtgctcaagaagggtgacctgggcatagtggacaag
ggcaagaacgatccgcagacggaggcagatcgctctgcccagcgttgcattatcgcctcc
ttggccaaaaagttccccaccgtcaagatcattggcgaggagggtggatccgatctgaat
gtctgcgacgactggctggtgaacgagttggatgaggaattcctgcagcacagttgcccc
gctgagtggaaggatgtcaagcccgaggactttgtcatatgggtagatcccctagacggc
acagcggagtatacacagggacacgttgaacacgtgaccgtcctgatcggcatagccgtg
aaggatgctgctgtgggcggcatcattcatcagccattctaccaacagcccgatggcgaa
atgggtcgcaccatttggggcctgaagggtctgggcacgggaggattcacggcagtcccc
gcgccagccggccagttcatcataaccaccactcgctcgcattccaatgccctgcatcag
caagccctcaacgcattcgcatccacagaagttctgaaagtcggaggcgctgggttcaaa
gtgctccagctgctggagggaaaggcccacgcgtacgtcttcgccacgccgggctgcaag
aagtgggacacctgcgcacccgaggccgttctagaggcccagggcggctgcctcaccaac
atcaacggcgagcactacgcctacaatgcggatgtggagcacgtgaatcgacagggagtg
ctggccagcctgggacaggaccatgccgcgctggtggaaaagattcccgccgaggtgcgg
gcagcagtgggagccaagtga

DBGET integrated database retrieval system