KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7793Help
Entry
Dmel_CG7793       CDS       T00030                                 

Gene name
Sos
Definition
Son of sevenless
Orthology
K03099  
son of sevenless
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG7793 (Sos)
   04630 Jak-STAT signaling pathway
    Dmel_CG7793 (Sos)
   04068 FoxO signaling pathway
    Dmel_CG7793 (Sos)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG7793 (Sos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:34D1-34D1
AA seq 1596 aa AA seqDB search
MFSGPSGHAHTISYGGGIGLGTGGGGGSGGSGSGSQGGGGGIGIGGGGVAGLQDCDGYDF
TKCENAARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQD
VEEKVNKSFPAPIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFL
VAVLEYISADILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSL
PAQRASATYEETVKELIHDEKQYQRDLHMIIRVFREELVKIVSDPRELEPIFSNIMDIYE
VTVTLLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLL
SKPGASSLTTAGHGFRDAVKYYLPKLLLVPICHAFVYFDYIKHLKDLSSSQDDIESFEQV
QGLLHPLHCDLEKVMASLSKERQVPVSGRVRRQLAIERTRELQMKVEHWEDKDVGQNCNE
FIREDSLSKLGSGKRIWSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRR
VDINDRPDSDDLKNSFELAPRMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSIL
QDIERKHPLRMPSPEIYKFAVPDSGDNIVLEERESAGVPMIKGATLCKLIERLTYHIYAD
PTFVRTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDTGTAGAGGMGGVGGDKEHKNS
HREDWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLEHVNGKSMRKW
VDSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLL
EFEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAI
MQRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDH
LKKYQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQ
YQNQPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPH
IPLKSPGIKPRRQNQTNSSSKLSNSTSSVAAAAAASSTATSIATASAPSLHASSIMDAPT
AAAANAGSGTLAGEQSPQHNPHAFSVFAPVIIPERNTSSWSGTPQHTRTDQNNGEVSVPA
PHLPKKPGAHVWANNNSTLASASAMDVVFSPALPEHLPPQSLPDSNPFASDTEAPPSPLP
KLVVSPRHETGNRSPFHGRMQNSPTHSTASTVTLTGMSTSGGEEFCAGGFYFNSAHQGQP
GAVPISPHVNVPMATNMEYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELS
PPPIPPRLNHSTGISYLRQSHGKSKEFVGNSSLLLPNTSSIMIRRNSAIEKRAAATSQPN
QAAAGPISTTLVTVSQAVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHPVEST
SSSYAHQLRMRQQQQQQTHPAIYSQHHQHHATHLPHHPHQHHSNPTQSRSSPKEFFPIAT
SLEGTPKLPPKPSLSANFYNNPDKGTMFLYPSTNEE
NT seq 4791 nt NT seq  +upstreamnt  +downstreamnt
atgttctcggggcccagcggccatgcccacaccattagctacgggggcgggatcggtctg
ggcactggaggcggcggcggcagcggtggtagtggtagtggctcacagggcggaggcggt
ggtattggcattggcggcggtggcgtggctgggctgcaggattgcgatggctatgacttc
accaagtgcgagaatgctgcgagatggaggggcttgtttacgccatcgctaaagaaggtg
ctggagcaagtgcatccacgggttaccgccaaggaggacgcactgctgtatgtggagaaa
ctctgtctgcggcttctggccatgctgtgcgccaagccgctgccccattccgtgcaggat
gtggaggagaaggtgaacaagtcctttccagcgcccatcgatcagtgggccctgaacgag
gccaaggaggtgatcaactcgaagaaacgcaagtctgtcctgcccacggaaaaggtgcac
acgctgctccagaaggatgtgttgcagtacaagatcgatagctccgtgtccgccttcctg
gtggccgtgctcgagtacatctcagcggacatactcaaaatggccggcgactatgtgatc
aagatcgcccactgcgagatcaccaaggaggacatcgaggtggtgatgaacgccgatcgt
gtgctaatggacatgctcaaccagagcgaagcccacatcctgcccagtcccctgtcactt
cccgcgcagcgtgcaagtgccacctacgaggagacggtcaaggagctgatccacgacgag
aagcagtaccaacgcgacctgcacatgatcatacgcgtctttcgtgaggagctggtgaag
atcgtgtccgatccgcgcgagctggaaccgatattctccaacataatggacatttacgag
gtgacggtcactctgctcggctccctggaggacgtcatcgagatgtcccaggagcagagt
gccccctgcgtcggtagctgctttgaggaactggccgaggccgaggagttcgatgtgtac
aagaagtacgcctacgacgttacctcgcaggcctcacgggatgctctcaacaatctcctg
tctaagccaggggcctcatctctgaccacagccggccatggcttccgcgatgcggtcaaa
tactatttgcccaagctgcttctggtgcccatttgccatgccttcgtgtatttcgactac
atcaagcatctcaaggatctcagctcttcgcaggacgacatcgagagcttcgaacaggta
cagggactgttgcatccactccactgcgatctcgaaaaggtaatggccagcctgtccaag
gagcgacaagttccggttagcggtcgagtgcgccgccagctggcaatcgagcggacacgg
gagctccaaatgaaggtggagcactgggaggacaaggacgtgggccagaattgcaatgaa
tttattcgcgaggattcgctgagcaaacttggatcgggaaaacgaatctggagcgagcgc
aaggtattcctcttcgacgggctaatggtgctatgcaaggcaaacaccaagaaacaaaca
ccatcggcaggagcaacggcctacgactaccgactgaaggagaagtatttcatgcgacgc
gtggatatcaacgatcgaccggacagcgatgatctgaagaacagttttgagttggcaccc
cggatgcagccgcccattgtgctgaccgccaagaatgcacagcacaagcacgactggatg
gcagacctgctgatggttatcaccaagtcgatgctggaccggcacttggacagcatattg
caagacatcgagcgaaagcatccgctgcggatgcccagtccggagatttacaagttcgcg
gtgccggacagcggtgacaatatcgtgttggaggagcgcgaaagcgcaggagtgccgatg
atcaagggagcgacgctttgcaagctaatcgagcgcctcacctatcacatctacgccgat
ccgacttttgtgcgcaccttcctcaccacatatcgctacttctgctcgccgcagcaattg
ctgcaactgctggtggaacgctttaacataccggatcccagcctggtctatcaagacacg
ggcacagcaggtgcgggtggaatgggcggcgttggcggtgacaaggagcacaagaactcg
catcgcgaggactggaaacgatatcgcaaggagtacgtgcagccagtgcagtttcgagtg
ctcaacgtactgcgccattgggtcgaccatcatttttacgatttcgagaaggatcccatg
ttgctggagaagctgctgaactttctggagcacgtgaatggcaaatcgatgcgcaagtgg
gtggattccgtgcttaagattgttcagagaaagaacgagcaggagaaaagcaataaaaag
attgtatacgcctatggccacgatccgccgcccattgagcatcaccttagtgtacccaac
gacgagataacgctcctcaccctgcacccactggaactggcccgtcagctcactctactg
gaattcgagatgtacaagaatgtaaagccgtctgagttggtcggatcaccctggacgaaa
aaggacaaggaggtgaagagccctaatctactgaagataatgaagcacaccacgaacgtc
acccgctggattgaaaaatccatcaccgaagcggagaactacgaggaacgcctggctatt
atgcaacgcgcaatcgaagtgatgatggtgatgctggaattgaacaattttaatggaatc
ctctcgattgtcgcggctatgggcacggcatctgtttatcgactgcggtggacattccag
ggattgcccgaacgctacagaaaattcttggaggaatgccgcgagctcagcgacgatcat
ctcaaaaagtatcaggagcgattgcgatccatcaatccgccttgtgtgccatttttcggt
cgctacttgaccaacatactccacttggaggagggtaaccccgacctgctagccaacaca
gagctaattaacttttccaaacgacggaaagtggccgagattattggcgagattcaacag
taccagaaccagccatactgcctcaacgaggagtccacaatacgacagttcttcgagcaa
ctggatccgtttaacggactgtccgacaaacagatgtccgactatctctataacgaaagc
ctgcgcattgagccaaggggctgcaagacagtgccgaaattccctcgaaaatggccgcac
attccgctcaaatcgccgggcatcaagccgcgtcgccagaatcagaccaacagcagtagc
aagctgtcgaacagcacgtcgtccgtggcggcggcagcggcagcatcgtcaacggccacc
tcaatagctacggcatcggcgccatctttgcacgcctccagcataatggatgcgccaaca
gcagcagcagctaatgctggatctggaactctcgctggcgagcaaagtccgcagcacaat
ccgcacgctttctccgttttcgcccctgttattatacccgaacggaacaccagcagctgg
agtggaacgccacagcacactcgaacggaccagaacaacggggaggtttcggtgccggcg
ccacatctccccaagaaaccgggcgcgcatgtctgggctaacaacaactcgacactggcc
agtgcgtcggcaatggatgttgtgttcagtccagcgctgccggagcatctgccaccgcag
tccctgccggacagcaatccattcgcatcggacacggaagctccaccgtcgccgctgccc
aagctagtggtcagtccgcgtcacgaaaccggcaatcgatcaccattccatgggcgcatg
cagaacagcccaacgcatagcactgccagtaccgtgacccttacaggcatgtctacatcg
ggcggggaggaattctgcgcgggtggattctactttaacagtgcccatcagggacagccg
ggggcagtgcccatctcgccgcatgtcaacgttccgatggccaccaatatggagtaccga
gcagtgccgcctccactgccacccagacgcaaggagcgcactgagagctgtgcggacatg
gcgcaaaagcgtcaggcgccagacgcacccacattacccccgcgtgatggcgaactcagt
ccgccgccgataccgccacggctcaaccattccacgggcatcagctacttgcgacaaagc
cacggcaagagcaaggagtttgtgggcaacagcagtctgctcctgcccaacaccagcagt
attatgatacgccgcaactcggcgatcgagaagcgggcagcggcaactagccagccaaac
caggcggcggcgggacccatcagcacgacactagtgaccgtgtcgcaggcagtggcgacg
gacgaaccgctgccgctaccgatctcgccagcggcaagctcctcgacgaccacatcaccg
ctgacacccgccatgtcgcccatgtctcccaacattcccagccatccggtggagagcacg
tcgagcagctatgcccaccaactgcgaatgcggcagcagcagcagcagcagacgcatcca
gcgatctactcgcagcaccatcaacatcatgccacccatctgccgcaccatccgcaccag
caccattcgaatccgacgcagtcgcgctcgtcccccaaggagttctttccgattgccacg
agcctcgagggcacacccaaacttccaccaaaacctagtctaagcgctaacttctataac
aatccagataaaggtacgatgtttctttacccaagtacaaacgaagaataa

DBGET integrated database retrieval system