KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7798Help
Entry
Dmel_CG7798       CDS       T00030                                 

Definition
CG7798 gene product from transcript CG7798-RA (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:52F11-52F11
AA seq 148 aa AA seqDB search
MWPIWLLVLLTLSLATGRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNTKAINPS
NVDGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFS
AWVAWNNRCQGVKPNVNHCFRRRHRNSG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccatttggctgctggtgctcttaacgctatcactggccactggccgccaggtg
ggcagatgcagtttggcccggcagctgtatcgatacggaatggcttacaacgagctaccc
gattggctgtgcctcgtggagggcgagagctcgttcaacacaaaagccatcaatccctcg
aacgttgatggatccgtggactggggtctcttccagatcaacgatcgttactggtgcaag
ccggcggatggtcgtccatccaacgatctgtgtcgcttgccctgccgcctgctgttgagc
gacgatatccggtattccattgcctgtgcgaagtacatcaggaaacagcaaggattctcc
gcctgggtggcttggaacaatcgatgtcagggtgtcaagcccaatgtgaatcactgcttc
cggcggcgacacagaaattcgggttga

DBGET integrated database retrieval system