KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7840Help
Entry
Dmel_CG7840       CDS       T00030                                 

Definition
CG7840 gene product from transcript CG7840-RA (EC:1.3.99.5)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dmel_CG7840
    1.3.1.94  polyprenol reductase
     Dmel_CG7840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:29A3-29A3
AA seq 326 aa AA seqDB search
MAPPENGILEVLENLLDRYKINLLQMMFGTFIATIVFFGGLMTFVEKYLPNSIRQSFRYG
KHSFKGETDPLVAWLEVPKSWFKHFYTFALFWSWLAFYVLVSTVREQKEAPEYVLQFLDI
MGGGRSHRKVEIDSTTACVGAFMLTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYVHYF
GAVIALLSNTSGFVRGSKPMEFSLDKLTSQQILYLGVFFLAWQQQYASNMILVNLRKDPR
TGSVKTEKHLLPKGGLFNLLSSPHMFLEVVMYFCIADLYMPVRIWRLIFLWVASNQTINA
LLTHKWYQETFREYPKNRRAIIPFLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcgccacccgaaaatgggatccttgaggtcctcgaaaatctacttgaccggtacaaa
atcaacctgctgcaaatgatgttcggcaccttcatcgccacgatcgtgttctttggcgga
ctgatgactttcgtggagaagtacctgcccaatagcatacgccagtcctttcggtatggc
aagcacagtttcaagggtgaaacggatcctttggtggcctggctggaggttccgaagtcc
tggttcaagcacttctacacatttgccctgttctggagctggctggcattttatgtgctc
gtttcaaccgttcgggagcaaaaggaggcgcccgaatatgtactccaattcctggacatc
atgggcggcggacgtagtcaccggaaggtggagatcgactcaacgactgcctgtgtgggc
gcatttatgctcacgttgcagtgcacccggcgtttttacgagaccaattttgtgcaaatc
ttctccaagaagagcaaaatcaatctgtcgcactatgccgtgggctatgtgcactacttt
ggagccgttatagctttactatccaatacctccggctttgtgcgcggctccaagcccatg
gagttcagcctcgacaagctgacaagccagcaaatactctacctcggcgtcttctttctc
gcctggcagcagcagtatgccagtaacatgatattagttaacctgcggaaggatccgcgg
acgggaagtgtcaaaacggaaaagcaccttctgcccaagggtgggcttttcaatctgctt
tcgtcgccgcacatgttcctcgaggtggtcatgtacttctgcatcgccgatctctacatg
ccagttaggatttggcgattgatcttcctctgggtggccagcaatcaaacgatcaatgct
ctgctaacccacaagtggtaccaggaaacattcagggaatatccaaagaaccgacgtgct
atcattccgttcctgctctga

DBGET integrated database retrieval system