KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7955Help
Entry
Dmel_CG7955       CDS       T00030                                 

Gene name
ABCB7
Definition
CG7955 gene product from transcript CG7955-RA (EC:3.6.1.3)
Orthology
K05662  
ATP-binding cassette, subfamily B (MDR/TAP), member 7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:dme02010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:62A8-62A9
AA seq 743 aa AA seqDB search
MAGLLHLTKQCSIHLPAHLGRAKCYTLAKGPGTHVQARVLYSSLTKVDDKNSSDAKRKKI
TPFTPTPGSKLLGGVFGKKAKGGAPAAAAAKTTTLQRQRPYRPQQQQSRLCHVHIGGGSD
GGSGLGKLDAPEVTSKDMLRAMMAYIWPKEDPLVRKRVGISLGLLAGSKLLTVCVPFLFK
GAVDTMTTLNMDTAPDAVLSAATALMLGYGIARASAAGFNELRNAVFAKVAHHSIRKIAS
NVFLHLHNLDLAFHLNKQTGALSKTIDRGSRGINFVLSAMVFNIVPTIFELALVSSILGV
KCGLAFAGVSMGCVGIYAAYTLSVTQWRTQFRVFMNQAENEAGNKAVDSLINYETVKYFN
NEKYEAGCYNEVLKKYEAASLKTSSSLALLNFGQNAIFSSALSLIMVLAAKEIAQGNMTV
GDLVMVNALLFQLSIPLGFLGSVYREVRQALLDMRAMFTLMNVDSSIQTAANAQPLFVDT
TNSSIEFRNVSFEYEPGKPIFRDLSFTIPAGKNVAIVGGSGSGKSSMVRLLFRFFEPNSG
KVLIGGQDISAVDLESLRKVIAVVPQDSVLFHNTIEHNIHYGNLSKSHAEVQNAARMADL
HDSIMSWPGQYSTQVGERGLKLSGGEKQRVAIARAILKNTPILIFDEATSSLDSITEHNI
LQALTRATSGRTSICIAHRLSTVKDADEILVLENGRVGERGTHSELLRQNGLYARLWETQ
TQQFDPSREINEEVAAKKTRGVA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggccggactccttcacctgaccaagcagtgcagcatccacctacccgcccacttggga
cgcgcgaaatgctacacactcgctaagggaccgggaacacacgtgcaggcaagagtgctg
tactcttcgctgactaaggttgatgataagaacagcagcgatgccaagcggaagaagatt
accccgtttacgcccacgccgggtagcaagctcctgggtggagtattcggcaagaaggcc
aaaggtggagccccagcagcagcagcagcaaaaacaacaacgctacagcggcagcgacct
taccgcccacaacaacagcaatcacgactatgtcatgttcatatagggggcggcagcgat
ggtggctcgggattgggcaagctagacgcgccggaggtcacctccaaggatatgctgcgt
gccatgatggcctacatctggccaaaggaggatccactggtgcgaaagcgggtgggtatt
tccctgggtctgttggctggctccaagctgctgaccgtctgtgtccccttcttgttcaaa
ggagctgtggacacgatgacaacgctgaacatggacactgccccggatgcggtcctctcc
gcagccaccgcactgatgttgggatatggcattgctagagccagtgcggcgggctttaat
gagttgcggaatgcagtgtttgccaaggtggcccaccactcgatccgaaagatcgccagc
aatgtgttcctgcatctgcacaacctggatctggccttccacctgaacaaacaaactgga
gcactgtcaaagaccatcgatcgaggatcgaggggcattaactttgtgctctccgccatg
gtcttcaacattgtgcccactatctttgagctggccctcgtgtccagtatcctgggagtg
aagtgtggcctggccttcgctggtgtcagcatgggctgcgttggcatatacgctgcctac
actctgagtgtgacccagtggcgcacccagttccgtgtatttatgaaccaggcggagaac
gaggccggcaacaaggccgtagactcgctgatcaactacgagacggtgaagtacttcaac
aacgaaaagtacgaggcgggttgctacaacgaggtgctgaagaagtatgaggcggccagc
ttgaagactagctccagtctcgctctgctcaactttggccagaacgccattttcagcagc
gcactgagtctgattatggtattggccgccaaggagattgcccaaggcaacatgacggtt
ggagatttggtgatggtcaacgccctgctcttccagctctcgatccccctcggttttctg
ggcagtgtttatcgtgaggtgcgacaggctttgctggacatgcgggccatgttcacgttg
atgaacgtggacagtagcattcagacagccgccaatgcccagcccctgttcgtggacacc
actaactcatccattgagttccgcaacgtgagcttcgagtacgaacctggcaagcccatt
ttccgggacctcagtttcaccatacccgccggtaaaaacgtcgccattgtgggcggctct
ggctcaggaaaatcgtcgatggtgcgccttctcttccgcttctttgagccaaactctggt
aaagtgttgatcggtggccaggatatcagcgccgtggatttggagagcctgcgcaaggtt
attgcagtggtgccgcaggattcggtgctattccacaacaccatcgagcacaatatccac
tatggcaacctgtccaagtcccacgcagaagtgcagaatgctgcccgcatggctgatttg
catgactccatcatgagctggccaggacagtactccactcaggtaggcgaacgtggatta
aagttatccggtggcgagaagcagcgcgttgccatcgctagggccatactgaagaacacc
cccattctgatctttgacgaggctacaagcagtctggactcgatcaccgagcataacatt
ctgcaggctctgacccgcgctacctcaggacgcactagcatttgcattgcccaccgtctc
tcgacagtcaaggatgcggacgagattctggtgctcgagaacggacgtgtaggtgaacgt
ggcacccattcggagctgctgaggcagaatggactgtatgcccgcctctgggagacgcag
acgcagcagttcgacccgagccgggagatcaatgaggaggtggcagcgaagaagacgcgg
ggcgtggcgtag

DBGET integrated database retrieval system