KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7985Help
Entry
Dmel_CG7985       CDS       T00030                                 

Definition
CG7985 gene product from transcript CG7985-RB (EC:3.2.1.-)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dmel_CG7985
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dmel_CG7985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:90F7-90F7
AA seq 708 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTASAQPPAAPISNSERQQQQQQS
TGYQQVHIIQKLIEQANRVLRAERLKDNAVEKSPSPVQRLGNVRSLRPTQAKKAPLPMSE
SFLFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHELQRMGVPVVAGI
GPDGPRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLA
AHNAYKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICPSQ
PQSMALLEQMLTQVIELHSQCLGQATPATNVPVARIRFTHIHIGCDEVQRMGECTTCRQR
LRSELFLSHVVSMAHFIRRQWPHLGVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYASD
IYRFIQPQLWDTYAKVFPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRF
SKGLRGLALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLRVLQCV
FQPDSRRSGRPWLELHPNAHHSQLFAVCNYPGHLVFKYALRLFDKLAEIRLYLQQTRDQS
AWLSDYNVRHNFSSPLRVRELTARTPMLIEELRAMAREAQQLLWEVYDEYTVTEFVEQHI
YPTIEALQRQLARAEMLLQRRTWPQRPLPLPLKVQEDMGLVTHQQEQQ
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcactcaaatctttggatatttatttggcgccggaaactttccttcctgctcgtcgtg
tctggcctggtgcttctcggcctctggacatgggccatactaatcgatacgacagcctca
gcacagcctcctgccgcccccatttccaattctgagcgccagcagcagcagcagcagtcc
acgggttaccagcaggtgcacatcatccagaagcttatcgagcaggcaaaccgggtgctg
cgtgccgagcggctcaaggataacgctgtcgagaaatcgccatcgccagtccagcggctg
ggaaacgtgcgttccctgcgacccacacaggccaagaaggcgccgctgcccatgtccgag
agcttcctgttcgagcaggagcgcctcaagattctggagcagcagcagcgccagagaaac
gccggtatggaggaactgaacgccaatgccgaggacgagcgaatgctcagttcggcggag
cgacagactcagtacgagcacgagcttcagaggatgggcgtgccggtggtggctggcatc
gggccggatggtccgagagctcccgccgagcgtctcgttcatctggacttgaagggtgct
ccgcctaagctaagctttctcaagcaactgctgcccgtgctgcgggcactgggagccact
ggtctgctcatagagtacgaggacatgtttccctacagcggagttcttcagccgctggcc
gcgcacaatgcctacaaggaggacgaactgcgggacttcctcgagtgcgctgcccttcat
ggactgagcgtaatgcctctcgttcaaacctttgggcacatggaatacgtcctcaaactc
tcgggcttcgagcagctgcgtgagctggctgagagtccacagtcgatttgccccagccag
ccacagagcatggccctgctggagcagatgctcacccaagtgatcgaattgcattcgcag
tgcttgggtcaggcgacgcccgccaccaacgttcccgtggcgcgaatcaggttcacccat
attcacatcggttgtgacgaggtgcagcgcatgggcgagtgcactacatgccgccagagg
ctacgcagtgagctcttcctctcgcacgtggtaagcatggcgcacttcattcgccgccag
tggccgcacctgggtgtggtaatctgggacgaccagttgcgatcgatgtccctcagcgag
ctgcagcactcgcaagtgggcagctacgtggagccgatggtttgggtgtatgccagtgac
atataccgattcattcagccacagctgtgggatacctatgccaaggtctttcccagcgcc
tggacggcgtcggcttttaagggagcctttggtgagagcttgttggtgccgccgctgcag
catcatcttgagaacaacatccgatggctggcagtgatcgccaaggaaggcggacgcttt
tcaaagggattaagaggtctggcactgaccggatggcagcggtatgatcatttcgcagta
ctctgtgaacttctgccagtaggcattcccagtctgatgacgtcgctgtcgaccgtctcc
aagggctacttcagcactaatccgcgggacaatgagctgctgcgtgtgctgcagtgcgtc
ttccagccggacagtcggcgatcgggtcgaccctggctggaactgcatccgaatgcccat
cacagtcagctctttgctgtctgcaactatccgggtcacctggtcttcaaatatgccctg
cgcctgtttgacaagctggccgagatccgactctatttgcagcagacccgggaccagagc
gcctggctctccgactacaatgttcggcacaacttcagttcgccgctgagggtgcgcgaa
ctgactgcgaggacgccgatgttgatcgaggagctgcgggcgatggcgagggaggcacag
cagctgctgtgggaggtatacgacgagtacacggtgacggagtttgtggagcagcacatt
tatcccaccatcgaggcactgcagcgccagttggccagggcggaaatgctgctccagcga
cgcacttggccacagagaccactgcctctgcccttgaaagtgcaggaggacatgggactg
gtgacgcatcagcaggagcaacaatga

DBGET integrated database retrieval system