KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7985Help
Entry
Dmel_CG7985       CDS       T00030                                 

Definition
CG7985 gene product from transcript CG7985-RB (EC:3.2.1.-)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dme00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:90F7-90F7
AA seq 708 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTASAQPPAAPISNSERQQQQQQS
TGYQQVHIIQKLIEQANRVLRAERLKDNAVEKSPSPVQRLGNVRSLRPTQAKKAPLPMSE
SFLFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHELQRMGVPVVAGI
GPDGPRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLA
AHNAYKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICPSQ
PQSMALLEQMLTQVIELHSQCLGQATPATNVPVARIRFTHIHIGCDEVQRMGECTTCRQR
LRSELFLSHVVSMAHFIRRQWPHLGVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYASD
IYRFIQPQLWDTYAKVFPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRF
SKGLRGLALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLRVLQCV
FQPDSRRSGRPWLELHPNAHHSQLFAVCNYPGHLVFKYALRLFDKLAEIRLYLQQTRDQS
AWLSDYNVRHNFSSPLRVRELTARTPMLIEELRAMAREAQQLLWEVYDEYTVTEFVEQHI
YPTIEALQRQLARAEMLLQRRTWPQRPLPLPLKVQEDMGLVTHQQEQQ
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcactcaaatctttggatatttatttggcgccggaaactttccttcctgctcgtcgtg
tctggcctggtgcttctcggcctctggacatgggccatactaatcgatacgacagcctca
gcacagcctcctgccgcccccatttccaattctgagcgccagcagcagcagcagcagtcc
acgggttaccagcaggtgcacatcatccagaagcttatcgagcaggcaaaccgggtgctg
cgtgccgagcggctcaaggataacgctgtcgagaaatcgccatcgccagtccagcggctg
ggaaacgtgcgttccctgcgacccacacaggccaagaaggcgccgctgcccatgtccgag
agcttcctgttcgagcaggagcgcctcaagattctggagcagcagcagcgccagagaaac
gccggtatggaggaactgaacgccaatgccgaggacgagcgaatgctcagttcggcggag
cgacagactcagtacgagcacgagcttcagaggatgggcgtgccggtggtggctggcatc
gggccggatggtccgagagctcccgccgagcgtctcgttcatctggacttgaagggtgct
ccgcctaagctaagctttctcaagcaactgctgcccgtgctgcgggcactgggagccact
ggtctgctcatagagtacgaggacatgtttccctacagcggagttcttcagccgctggcc
gcgcacaatgcctacaaggaggacgaactgcgggacttcctcgagtgcgctgcccttcat
ggactgagcgtaatgcctctcgttcaaacctttgggcacatggaatacgtcctcaaactc
tcgggcttcgagcagctgcgtgagctggctgagagtccacagtcgatttgccccagccag
ccacagagcatggccctgctggagcagatgctcacccaagtgatcgaattgcattcgcag
tgcttgggtcaggcgacgcccgccaccaacgttcccgtggcgcgaatcaggttcacccat
attcacatcggttgtgacgaggtgcagcgcatgggcgagtgcactacatgccgccagagg
ctacgcagtgagctcttcctctcgcacgtggtaagcatggcgcacttcattcgccgccag
tggccgcacctgggtgtggtaatctgggacgaccagttgcgatcgatgtccctcagcgag
ctgcagcactcgcaagtgggcagctacgtggagccgatggtttgggtgtatgccagtgac
atataccgattcattcagccacagctgtgggatacctatgccaaggtctttcccagcgcc
tggacggcgtcggcttttaagggagcctttggtgagagcttgttggtgccgccgctgcag
catcatcttgagaacaacatccgatggctggcagtgatcgccaaggaaggcggacgcttt
tcaaagggattaagaggtctggcactgaccggatggcagcggtatgatcatttcgcagta
ctctgtgaacttctgccagtaggcattcccagtctgatgacgtcgctgtcgaccgtctcc
aagggctacttcagcactaatccgcgggacaatgagctgctgcgtgtgctgcagtgcgtc
ttccagccggacagtcggcgatcgggtcgaccctggctggaactgcatccgaatgcccat
cacagtcagctctttgctgtctgcaactatccgggtcacctggtcttcaaatatgccctg
cgcctgtttgacaagctggccgagatccgactctatttgcagcagacccgggaccagagc
gcctggctctccgactacaatgttcggcacaacttcagttcgccgctgagggtgcgcgaa
ctgactgcgaggacgccgatgttgatcgaggagctgcgggcgatggcgagggaggcacag
cagctgctgtgggaggtatacgacgagtacacggtgacggagtttgtggagcagcacatt
tatcccaccatcgaggcactgcagcgccagttggccagggcggaaatgctgctccagcga
cgcacttggccacagagaccactgcctctgcccttgaaagtgcaggaggacatgggactg
gtgacgcatcagcaggagcaacaatga

DBGET integrated database retrieval system