KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7995Help
Entry
Dmel_CG7995       CDS       T00030                                 

Gene name
Gk
Definition
CG7995 gene product from transcript CG7995-RC (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmel_CG7995 (Gk)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dmel_CG7995 (Gk)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG7995 (Gk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:62B1-62B1
AA seq 576 aa AA seqDB search
MTEGKNLPHSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHR
VELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGFSASDIVTVGITNQRETTIVW
DAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYFSALKIRWLRDNV
PEVRQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFG
IREEMLPTIHSCSEIFGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWLQNKVRILPDS
RDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNARGIIIGLTQFTRKNHIVRAALESICF
QTRDILECMHQECGYEINKLHADGKLTTNNLLMQLQADTIGMPVFRSQLMDSTAFGAAMC
AAQADGVNLCQFEPEKRYYENVHYDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKT
REYTEENYRMLSSLPASIFLISSFAMLVHSLAASGQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagggcaagaacttaccccactctagtgcggatgtgccgttccgcagcaaggag
ctgcgcaagcaatcgctcatccagcacaccggcctggtcggagtcatcgatgagggcacc
aagaccatcggtttctccatctacaccacgccggacttcaaggagatcgccgcacaccgg
gtggagctgagcgtgatcacgccccaggatggctggtatgagcaggatccgctggagatg
atggcctcgatcaacaagtgcgccgaggaggccatcaagcagctacccgaacagggtttc
tctgccagcgacattgtcaccgtgggcataaccaaccagcgcgagacgacaatcgtctgg
gatgcggtcaccggcaaaccgctgtacaatgcgctcctgtggaaggacatccgcactagc
actacagtggagcagatcgtggccaaggtgcaggatccgaaccacttccgcagcagcact
ggcctgcccatctccacgtacttctcggccctcaagatccgctggctgcgggacaatgtg
cccgaggtgcgacaggccatccgggaaaggcgatgcaaggcgggcacagtcgacagctgg
atcgtctggaacttgacaaacggagctctccacatcacggatgtaacgaatgcctcccgc
actctgctcatgaatctggagacgcaagcctgggatcctgttctgctcaagacgttcggt
atcagagaggagatgctgcccaccatccacagctgttcggagatatttggcaagatcact
tcggagcgaagtccactgcgtgggatgaccctaagtggaataatgggcaaccagcaggcc
tcgcttctgggccagatgtgcgtgaagccgggtcaaacgaagaacacctaccgatccggc
tgttttctgctctgcaatacgggggacaagccggtcttttccaggcacggtctgctcacc
accgtggcttacaaactcggtccccaggcaccgacgatttacgcaattgagggagctgtg
tcggtggccggacatgcgctgtcctggctgcaaaacaaggtgcgtatcctgccggactcc
agagatgccgagaaatatgcggagatggtgcccacatcgggggatgtgtacttcgtgccc
gcctttacaggactatatgctccctactggcggcagaatgctcgcggcatcatcattggg
ctcacgcagttcacccgtaagaatcacatagtgagagctgcactggagagcatctgcttc
cagacgcgcgacatcctagagtgcatgcatcaggagtgcggttacgaaatcaataagctt
catgctgatggcaagctcaccacgaacaacctgttgatgcaactccaggcggacaccatt
ggcatgcccgtcttccgctcccagctaatggactccaccgctttcggggcagccatgtgc
gccgcccaggcagatggtgtcaatctctgccagttcgagcctgagaagcgatactacgag
aacgtgcactacgacaccttcctggccaccaccacggatgtagagcgaaaggagcgatac
ggcaagtggaagcgggcggtggagcgcagtttgggatgggtcatcaagcagaagaagacg
cgtgagtacacggaggagaactaccgcatgctgtcctctctgccagcgagcatcttcctc
atcagcagcttcgccatgctggtgcattccctcgctgcgagtggccagtaa

DBGET integrated database retrieval system