KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7997Help
Entry
Dmel_CG7997       CDS       T00030                                 

Definition
CG7997 gene product from transcript CG7997-RB (EC:3.2.1.22)
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dmel_CG7997
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmel_CG7997
   00600 Sphingolipid metabolism
    Dmel_CG7997
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Dmel_CG7997
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmel_CG7997
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dmel_CG7997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:53C1-53C1
AA seq 417 aa AA seqDB search
MYGTWGVFLGGILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKL
FQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHNQ
GLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMASGYPEFG
RLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQHCNLWRNWDDIEDSLESLMQIIDYFA
KNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLAAVRPEI
KAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGA
PYRIPFTVKELGLTNPKGYNVQDLYDASSKLGVFQSESQFITRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacgtggggcgtctttctgggcgggattcttctgctgcaggttctgcaatta
tccatgggcctcgataatggcctggcactaaagccacctatgggctggatgtcctgggag
cgattccgttgcatcaccgactgtaaactgtatccggatgagtgcatcagtgaaaaactt
ttccaaagacatgcggatctcctggtttctgaaggatatgcggatgctggctacgagtac
gtcatcatagatgactgctggctggagaagaatcgcgacaacgatacccagaagctggtt
ccggacagaaagcgctttcccaacggcctaaatgctttatccgatcatatccacaaccag
ggtctgaagtttggcttgtatcaggattacggcaccaacacctgcgctggctatcccgga
gtgatcaagcatatgaagctggacgcccaaacctttgcggattgggatgtggactacgtg
aagctggacggctgttatgccaatatcagcgacatggcctcgggctatccggagttcgga
cgcctgctcaatgaaactggtcgaccgatggtatactcctgcagttggcccgcgtatcag
gaggatgcaggagaaatgcccgattatgagtcactcaagcagcactgtaatctgtggcgc
aactgggacgacatcgaagactcgctcgagtcccttatgcagatcattgactactttgcc
aagaatcaggacaggattcagccgcatggcggaccaggacattggaacgatccagatatg
ctgctgctgggaaactacggcttgagctacgatcaaagcaagctgcagatggcgatttgg
gccattatggcagctcctctaattatgtccaatgatctggctgcagtgcgtcccgagatc
aaggctatactccagaatcgtgcggttattgctgtggaccaggatgagctgggcatccag
gggcgccgtgttttgtcccgcaaccaaatcgaagtctggaagcgtcccattacgccagta
accaagagtggacatcactcctatgctgtcgcctttgtcagtcgccgagatgatggcgct
ccctacaggatccccttcacggtcaaggagctcggattgacgaatcccaagggttataat
gtgcaggatctgtacgatgccagcagcaagttgggcgtcttccagtctgagagtcagttc
atcacacgcgtcaatcccaatggcgtaactttctacaagtttacagcgttgtaa

DBGET integrated database retrieval system