KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8173Help
Entry
Dmel_CG8173       CDS       T00030                                 

Definition
CG8173 gene product from transcript CG8173-RA (EC:2.7.11.-)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG8173
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   Dmel_CG8173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:16C1-16C1
AA seq 398 aa AA seqDB search
MDTPRRKLRNLHLENVQNSSTPINVPPSPMMKTLGHGTGIRVYRLDRSPRLGEIRSPWAV
KRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLG
SILEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEAHLMHGDLKSFNVLVKGEFEICKL
CDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETL
ALVPPHTLELDAALGEDMDSSHDLPTDTDKLQCKQLDFSSDENKNGLPSAMEEHTDNDMS
QDYDEEDDEEEKEEEEEDDEEDDDTKENDISYFTLNNLHSAYGTRPPLPVAFQLSDDYNC
VVELFYLCTNALSEDRPAAKTIWQCLENNGANVATESD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccacgccgcaagctaagaaatttgcacctggagaatgtccagaacagcagc
actcccatcaacgtgccgccatcgccgatgatgaagaccctgggccacggcactgggatc
cgggtctaccgcttggaccgctcgcctcgtctcggcgaaatccgctcgccctgggccgtc
aagcggatcacgcagaacatgcgggtcaagaaggatacactcttcaacgagcgaattgtt
cacgaggccgatatcctgcgcaaactgaagcatccaaacatcgtgggattccgtggcgtt
atcaccaatgacgagggcatcaacacactggcacttgaaatgtgcaccacttcactgggc
tccatactcgaggagcgacacgacgaggatctgggcccgttgccggccaaacatacctat
aagatgatcatggacgtggcccaggcactagactttcttcacaacgaagctcacctcatg
cacggcgaccttaagtcctttaatgtcctggtcaaaggcgagtttgagatttgtaagctg
tgcgattttggagtctctcttccgctggacgagcagggcgaggttaatttcctaaagaat
cccggactgcgctatgtgggaactaacctctggtgcgcaccggaggtcatagacgaagtg
gatgttattgacagcaaggcagacatattcagctttggcctggttatctacgaaaccctt
gctttggtgcctccacataccttggagcttgatgcagcactgggagaggatatggacagt
tcgcacgatttacccaccgacacggacaagctgcagtgcaaacagttggacttctccagc
gatgaaaacaagaacggactaccttctgcaatggaagaacacacagacaacgatatgagt
caagattatgacgaggaggatgatgaggaggagaaggaagaggaggaggaagacgatgaa
gaagatgatgacacgaaggagaacgatatctcttactttacactgaataaccttcattcc
gcctatggtacacgaccaccattgccagtggcctttcaacttagcgacgattacaactgc
gtcgtggagctgttttatctgtgcacaaatgctctcagcgaggatcgtccagcggccaag
accatttggcagtgcctggagaacaatggcgcaaatgttgcgacagaaagcgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system