KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8232Help
Entry
Dmel_CG8232       CDS       T00030                                 

Definition
CG8232 gene product from transcript CG8232-RA (EC:3.1.13.4 3.1.2.15)
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
K12571  
PAB-dependent poly(A)-specific ribonuclease subunit 2 [EC:3.1.13.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dmel_CG8232
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG8232
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     Dmel_CG8232
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG8232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:44F8-44F9
AA seq 1241 aa AA seqDB search
MDYVYCGTDPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVELVPVLADGGE
HFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQVHATDIVRDISTLDSGVLAL
TQTSLRHQIRRGLPKFTFKSNNMKEMVSMLQLSPHRLVMAGLQDELIDFDLRTLKETRIE
HVGAGGCTVLRKNSRYLFAGDQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISC
GYSGRQNNLAIDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLV
DTVELSEPRVSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQTPQPQFNLYS
RSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFSDWPEELLRYRYHRPKTIDPE
VLSNMKMQGPIGYSPNPRTARRNQIPYVIEQGGVCSPNGNGTAAATKAENGVKIIPRRYR
KVELKYTKLGTQDFDFDQHNQTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIK
EFCLSCELGFLFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLISLIQ
NWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYDSISDENSKED
DRERSKINAETDISKIFGTKQICINRCIKCQEEKIKESILLACNLSYPNHIKDSDQYFNF
GTILKRSLSSEKSIQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLN
RCSEKTTVDAAASLSTSKPCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKS
WFPLTFTMGINDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDD
GTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCI
LFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADAT
LQPLQSDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPA
EGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIF
VGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSETHDSIED
ARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPED
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggattacgtgtattgcggcaccgaccccatcggggcctccgaagacatactaagtgtt
tatgacgcgggatctgcgccgggaaacgggcacttttcgcccagcttcaatggattcaac
atcggcaccaccgatccggaatatgtggagcttgtgcccgtgcttgccgacggcggggag
cacttcggcgtttccagcgtggcgttcgacgactacgaagagctgctgtggatgggcaac
cagggcggccacgtcacatcgtactacacaaactccatgcagaagtacacatcctttcag
gtccacgccaccgacattgtgcgcgacatctccaccctggactccggagtgctggcgctc
acgcagacctcgctgcgtcatcagatccgcaggggtctgcccaagtttaccttcaaatcg
aacaacatgaaggagatggtgagcatgctgcagctatcaccgcatcgtctggtcatggcc
ggactgcaggacgagcttatcgacttcgacctgcgcacgctcaaggaaacccgcatagag
catgtgggtgccggcggatgcacggtgctacgcaagaattcacgttatctgtttgccggc
gaccagctgggaacggtaacgttgcgcgacctgaacagcctgagtgttcagcacacaatc
aagacgcacaccaacatcctttcggacttcagtgtccagggaaatctgctaatctcttgc
ggctacagcggaaggcaaaataacctggccatcgaccgcttcctaatggtctacgatctg
cgcatgctgcgcctgatcgcgcccattcaagtgatgattgatccgcagatgttgaagttc
ctgccatcgctgacatcccaactggccgtcgtgtccagctacggccaggttcagctggtg
gacactgtggagctcagcgagccgcgagtatccatgtaccagatcaacaccaacggcagc
cagtgcctcagcttcgacattagctcctcttcacaggccatggcatttggggaccagtcg
ggccacatcaacatgattgccgctgtacaaacgcctcagccgcagttcaatctctactcg
cgaagcacagagtttgcggacgtggtgccacagctgccgatggtctccattacggacacc
aactttccgctatcgtcggtcatgctaccgcacttgacgacgggcacacaatggttctca
gattggccggaggaactgctgcgctaccgctaccacaggcccaagaccattgatcccgaa
gtgctgagcaacatgaaaatgcagggaccgattggatactcgccaaacccacgcaccgcc
cgtcgtaatcaaattccgtacgtgattgagcagggcggcgtgtgcagtccgaacggaaat
ggaactgcggcggcgaccaaggcggagaacggtgtgaaaatcattccacggcggtatcgc
aaagtcgagctgaagtacacgaagctgggcacccaggactttgactttgaccagcataat
caaacatgtttcgcggggctggaggcaacgctaccgaactcctactgcaatgctatgcta
cagattttgtatttcaccgacgcgcttcgcgtgaagctgctggagcattcgtgcatcaag
gagttttgcctgtcctgcgaactagggttcctcttcaacatgctggataaaagtaccgct
tcttcaccttgccaggccagcaatttcctgcgatctttccgcactgtgccagaggcctcg
gcactgggattgattctcaccgaccgctcatcgaacgtcaatctaatatcgctgatacag
aactggaaccgattcattttgcatcaaatgcattacgaaatattcgattctagcaagaac
gcatccacctacagcggatctgtgcaaacatcaacgaacgcggaaaacgcgggctcttca
gaaacaagtggctcctcggacctttacgattccataagtgatgagaactccaaggaggac
gatcgggaacgcagtaagatcaacgcagaaactgacatcagtaagatctttgggaccaag
caaatctgtataaaccgctgcatcaaatgccaagaagagaagataaaggaaagcattcta
cttgcctgcaatttgtcgtatcccaaccacatcaaagatagtgatcagtatttcaacttt
ggcaccattttgaagcgatctctcagctccgagaagagtattcaggccttctgcgagaga
tgtaagaagttttcgccaaccaatcagagcgtgaaggtgacttcgcttccgcaaattctg
tccattaactgtggcctcaacaacgaaaaagacattaccttcctgaagcgccagctcaat
cgctgcagcgaaaagacgactgttgatgcggccgcttccttgagcacaagcaagccgtgt
cgatatggagccaactgttcgcgaagtgactgccatttcatgcatccggatcgaaaatct
ccatcgcacacaagccaaccgaatgctgtcaacaattctcccaatggacgccaaaagtcc
tggtttccccttacatttactatgggcatcaatgaccaaggtgaggtgcaggtgcaaact
caatcagatgcaagcagtggcaaatcggaacaggaggaggaaacggaaaagccaccaaca
aagggcttggacaacaatcggatgtacgcgctgcatgccgtggtgtgccaagtcgatgat
ggtacccaaaagaacttggtatcgttgataaatgtgcagcggccataccacaccatgaaa
ctggctgaatctgcagatgaccctcagagtcaatggtatatttttaatgattttagcata
tcgcccgtttcgccacaagaatcggtatggttcacattggattggaaagttccttgcata
ctcttctacagacacgtagaggatgactctgagtctgctagtactactagctcgaccgtc
acggaaagtgaagaaaccattccatcagagagcagcagcggctcgccaacaaatctatcc
aacccttttctagaggaaattgtgagtcctatgctaggcaacttaagtgcagacgccacg
ctgcagcccctgcagtcagatgaaatgccgcagtcgggtgatctggtcgcaatggatgcc
gagttcgttaccctaaatccagaggaaaatgagattcgcccggatggcaaaacggcgacc
attaagccatgccacatgagtgtggcccggatttcatgtatacgaggacaaggcccggct
gaaggagttccattcatggacgattacatatccacccaggagaaggtcgtggactaccta
actcagttctcgggaatcaagcctggcgacttggacgctaacttcagcaaaaagcgactg
actgccttgaagtactcataccagaaattaaaatacctcgttgacgtaggagtaatattt
gtcggacatggtctgaagaacgactttagggtcataaacatctatgtaccgtcggagcag
ataatagatacggtgcacctgtttcacatgccacatcatcgcatggtttccctaagattt
ctagcctggcatttcttgggtactaagattcagtccgagacgcacgactccatcgaagat
gcacggaccactctgcagctctacaagcactatttgaagctgcaggaggagaagaagttt
gccaacgctctcaagaatctttacgaacgcggaaagcagctgcagtggaaggttccagag
gactga

DBGET integrated database retrieval system