KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8232Help
Entry
Dmel_CG8232       CDS       T00030                                 

Gene name
PAN2
Definition
(RefSeq) PAN2 ortholog (S. cerevisiae) (EC:3.1.13.4)
  KO
K12571  
PAB-dependent poly(A)-specific ribonuclease subunit 2 [EC:3.1.13.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dmel_CG8232 (PAN2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     Dmel_CG8232 (PAN2)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     Dmel_CG8232 (PAN2)
  mRNA degradation factors
   3'-5' decay
    Pan complex
     Dmel_CG8232 (PAN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:44F8-44F9
AA seq 1240 aa AA seqDB search
MDYVYCGTDPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVELVPVLADGGE
HFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQVHATDIVRDISTLDSGVLAL
TQTSLRHQIRRGLPKFTFKSNNMKEMVSMLQLSPHRLVMAGLQDELIDFDLRTLKETRIE
HVGAGGCTVLRKNSRYLFAGDQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISC
GYSGRQNNLAIDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLV
DTVELSEPRVSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQTPQPQFNLYS
RSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFSDWPEELLRYRYHRPKTIDPE
VLSNMKMQGPIGYSPNPRTARRNQIPYVIEQGGVCSPNGNGTAAATKAENGVKIIPRRYR
KVELKYTKLGTQDFDFDQHNQTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIK
EFCLSCELGFLFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLISLIQ
NWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYDSINENSKEDD
RERSKINAETDISKIFGTKQICINRCIKCQEEKIKESILLACNLSYPNHIKDSDQYFNFG
TILKRSLSSEKSIQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNR
CSEKTTVDAAASLSTSKPCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSW
FPLTFTMGINDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDDG
TQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCIL
FYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATL
QPLQSDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAE
GVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFV
GHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSETHDSIEDA
RTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPED
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggattacgtgtattgcggcaccgaccccatcggggcctccgaagacatactaagtgtt
tatgacgcgggatctgcgccgggaaacgggcacttttcgcccagcttcaatggattcaac
atcggcaccaccgatccggaatatgtggagcttgtgcccgtgcttgccgacggcggggag
cacttcggcgtttccagcgtggcgttcgacgactacgaagagctgctgtggatgggcaac
cagggcggccacgtcacatcgtactacacaaactccatgcagaagtacacatcctttcag
gtccacgccaccgacattgtgcgcgacatctccaccctggactccggagtgctggcgctc
acgcagacctcgctgcgtcatcagatccgcaggggtctgcccaagtttaccttcaaatcg
aacaacatgaaggagatggtgagcatgctgcagctatcaccgcatcgtctggtcatggcc
ggactgcaggacgagcttatcgacttcgacctgcgcacgctcaaggaaacccgcatagag
catgtgggtgccggcggatgcacggtgctacgcaagaattcacgttatctgtttgccggc
gaccagctgggaacggtaacgttgcgcgacctgaacagcctgagtgttcagcacacaatc
aagacgcacaccaacatcctttcggacttcagtgtccagggaaatctgctaatctcttgc
ggctacagcggaaggcaaaataacctggccatcgaccgcttcctaatggtctacgatctg
cgcatgctgcgcctgatcgcgcccattcaagtgatgattgatccgcagatgttgaagttc
ctgccatcgctgacatcccaactggccgtcgtgtccagctacggccaggttcagctggtg
gacactgtggagctcagcgagccgcgagtatccatgtaccagatcaacaccaacggcagc
cagtgcctcagcttcgacattagctcctcttcacaggccatggcatttggggaccagtcg
ggccacatcaacatgattgccgctgtacaaacgcctcagccgcagttcaatctctactcg
cgaagcacagagtttgcggacgtggtgccacagctgccgatggtctccattacggacacc
aactttccgctatcgtcggtcatgctaccgcacttgacgacgggcacacaatggttctca
gattggccggaggaactgctgcgctaccgctaccacaggcccaagaccattgatcccgaa
gtgctgagcaacatgaaaatgcagggaccgattggatactcgccaaacccacgcaccgcc
cgtcgtaatcaaattccgtacgtgattgagcagggcggcgtgtgcagtccgaacggaaat
ggaactgcggcggcgaccaaggcggagaacggtgtgaaaatcattccacggcggtatcgc
aaagtcgagctgaagtacacgaagctgggcacccaggactttgactttgaccagcataat
caaacatgtttcgcggggctggaggcaacgctaccgaactcctactgcaatgctatgcta
cagattttgtatttcaccgacgcgcttcgcgtgaagctgctggagcattcgtgcatcaag
gagttttgcctgtcctgcgaactagggttcctcttcaacatgctggataaaagtaccgct
tcttcaccttgccaggccagcaatttcctgcgatctttccgcactgtgccagaggcctcg
gcactgggattgattctcaccgaccgctcatcgaacgtcaatctaatatcgctgatacag
aactggaaccgattcattttgcatcaaatgcattacgaaatattcgattctagcaagaac
gcatccacctacagcggatctgtgcaaacatcaacgaacgcggaaaacgcgggctcttca
gaaacaagtggctcctcggacctttacgattccataaatgagaactccaaggaggacgat
cgggaacgcagtaagatcaacgcagaaactgacatcagtaagatctttgggaccaagcaa
atctgtataaaccgctgcatcaaatgccaagaagagaagataaaggaaagcattctactt
gcctgcaatttgtcgtatcccaaccacatcaaagatagtgatcagtatttcaactttggc
accattttgaagcgatctctcagctccgagaagagtattcaggccttctgcgagagatgt
aagaagttttcgccaaccaatcagagcgtgaaggtgacttcgcttccgcaaattctgtcc
attaactgtggcctcaacaacgaaaaagacattaccttcctgaagcgccagctcaatcgc
tgcagcgaaaagacgactgttgatgcggccgcttccttgagcacaagcaagccgtgtcga
tatggagccaactgttcgcgaagtgactgccatttcatgcatccggatcgaaaatctcca
tcgcacacaagccaaccgaatgctgtcaacaattctcccaatggacgccaaaagtcctgg
tttccccttacatttactatgggcatcaatgaccaaggtgaggtgcaggtgcaaactcaa
tcagatgcaagcagtggcaaatcggaacaggaggaggaaacggaaaagccaccaacaaag
ggcttggacaacaatcggatgtacgcgctgcatgccgtggtgtgccaagtcgatgatggt
acccaaaagaacttggtatcgttgataaatgtgcagcggccataccacaccatgaaactg
gctgaatctgcagatgaccctcagagtcaatggtatatttttaatgattttagcatatcg
cccgtttcgccacaagaatcggtatggttcacattggattggaaagttccttgcatactc
ttctacagacacgtagaggatgactctgagtctgctagtactactagctcgaccgtcacg
gaaagtgaagaaaccattccatcagagagcagcagcggctcgccaacaaatctatccaac
ccttttctagaggaaattgtgagtcctatgctaggcaacttaagtgcagacgccacgctg
cagcccctgcagtcagatgaaatgccgcagtcgggtgatctggtcgcaatggatgccgag
ttcgttaccctaaatccagaggaaaatgagattcgcccggatggcaaaacggcgaccatt
aagccatgccacatgagtgtggcccggatttcatgtatacgaggacaaggcccggctgaa
ggagttccattcatggacgattacatatccacccaggagaaggtcgtggactacctaact
cagttctcgggaatcaagcctggcgacttggacgctaacttcagcaaaaagcgactgact
gccttgaagtactcataccagaaattaaaatacctcgttgacgtaggagtaatatttgtc
ggacatggtctgaagaacgactttagggtcataaacatctatgtaccgtcggagcagata
atagatacggtgcacctgtttcacatgccacatcatcgcatggtttccctaagatttcta
gcctggcatttcttgggtactaagattcagtccgagacgcacgactccatcgaagatgca
cggaccactctgcagctctacaagcactatttgaagctgcaggaggagaagaagtttgcc
aacgctctcaagaatctttacgaacgcggaaagcagctgcagtggaaggttccagaggac
tga

DBGET integrated database retrieval system