KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8298Help
Entry
Dmel_CG8298       CDS       T00030                                 

Definition
CG8298 gene product from transcript CG8298-RC (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmel_CG8298
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dmel_CG8298
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG8298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:48D5-48D5
AA seq 596 aa AA seqDB search
MSNGRYGRFGALIGVACVSSTHCRFLIYSTKNAEVLAYHELKLRQIVHQAGWMEYDPSEI
WKNTQECIETAYKNLVILEINPRDIIAIGIVNQRGTSVLWNLETGQPLHNAIGWSDCRST
PILKTLLHNVRHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPAVATAIEENKCLFGTLDS
WLLWNLTGGVEMGVHSTDITNAHYTSLMNVSTEQWDPKLCQFFRLPLNILPRIRSNSEIF
GYVLEGPLHGTPIAAMMGEQPASLLGQLCVKAGQNVCTLDDSCFVLLNTGREKLDSANGL
ITGIAHKLGEKAATNYTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTFIGENS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGMYAPYWRHDARGIILGLTSQTTAENITQ
AAYEATGFQIFEVLQAFKRDTPNWDRSSMQPVLTFGGDYAENLHLVQFIADIIGYMLERP
QTTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVFSPTTTKNRRELLYKRWAYAVKKC
LHWNNYETYEADIELFAQRELDPNLPVRRSVPGSIFLTTSFAMIILANYLKSNPLK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacggtcgttacgggagattcggagcactcatcggcgtcgcctgcgtgagcagc
acccactgccgctttctgatatactcaacgaaaaatgccgaggtcctggcctaccatgag
ctgaagctgcgacagattgtccaccaggcgggctggatggagtacgatccgtcggagata
tggaagaacacacaggagtgcatagagaccgcctataagaacctggttatactagagatc
aatccacgtgatattattgccatcggtatcgtaaatcagcggggcacctcggtgttatgg
aatttggagacgggacagccactgcacaatgccatcggatggtcagattgccgtagcact
cccatcctaaagaccctgctccataatgtccggcacaatgtggactacgtgaggtatcgc
agtggcttgcccctgagcagctgtttcagtgccctaaagatccgttggctaatggatcac
gttcctgccgtagccactgccattgaggagaacaagtgcttattcggcaccttggactcc
tggcttctgtggaacctaaccggcggcgttgagatgggtgtgcactctactgacattacc
aatgcccactacacttcccttatgaacgtgtccacagagcagtgggatcctaaactctgc
cagttctttcgattgcccctgaacatactgccacgcatacgatccaactccgaaatcttc
ggctatgtgctggagggtcctttgcatggcactcccatagcggccatgatgggtgagcag
cccgcaagtttgttgggccaactctgcgtgaaggccgggcaaaatgtctgtaccctggac
gacagctgtttcgtgctccttaacacgggcagggagaagctggactctgcaaacggactg
ataacgggcatagcgcacaagctgggcgaaaaagcggccactaactacacactcgaggga
gccatttcaaatgccggttccacggttacatggctgcgggataagctacagatcaatact
gagattaattccaatgataatgtggtggagtctttgaatacattcatcggcgagaactcg
atgatctcgtcctcttgttcctcatccatgctgaatgccgagtgtggactggcagccaag
aggtcggagattacgtttgtgccggcatttcatggcatgtacgcaccctactggcgacac
gatgccaggggcataatcttgggacttaccagccagactacagcggaaaacattacccaa
gctgcttacgaggccaccgggttccagatctttgaagtgctacaggcgttcaagcgcgat
acacccaactgggaccgatccagcatgcaacccgtgctgacattcggcggtgattacgcc
gaaaacttgcatttggtgcagttcatagcagatattattggctatatgttggagcgtcca
cagaccacctcacctgctggattgggcgttatgataaccgcgggcgtgacgatgaaagtg
gtgtccctggagcacgccgtaaaaatgtacaccccgcccactgatgtcttttcgccaaca
actaccaaaaatcgtcgagagctgctctacaagcgctgggcttatgcggtaaagaaatgc
ctgcactggaacaactacgagacgtacgaggctgatattgagctgtttgctcagcgagaa
cttgatcccaatttacctgtaaggcgttccgtaccgggcagtatattcctgaccacttct
tttgcgatgattatcctggctaactacttaaagtccaatcccctgaaatag

DBGET integrated database retrieval system