KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8334Help
Entry
Dmel_CG8334       CDS       T00030                                 

Definition
CG8334 gene product from transcript CG8334-RB (EC:3.1.2.15)
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG8334
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG8334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:76D3-76D3
AA seq 1715 aa AA seqDB search
MLYAACGGTQRGISFNDLLCGLVLITRGTQAEKTKFLWNLYCNDAGTFIIKSDYVRNVNL
APFESVSLFAQSERVNFEQFQDWIIKHRNATVLSKWLLSDNCVSLTSELETPTFYQSLAG
VTHLEEKDIGDLEKEFWRLKNTSQNGQIDLQFLGPLISPPIPKNALAGLFNAFDENRDGH
IDFKELCCGVSAACRGPGVERTRFCFKIFDVDRDGVLSHDETLQMINVLLLVAKENQESQ
QYKDLTKQLVISDLLEFGQRRSPDGTPSKLTRDNVSLTAEDFMLWTVQCDLRLMQPLLDL
IFELCHIVFGLWPQCKHMENDIVRGWLRREERRPYRVGQFWYLITHDWWLSWMQYTQHTT
HTCDYCKRTASQRTAVDEALVCDESFNTHSLEQHDSYSLGSGTGSASGSGSASSGISAGR
HCGPVRPGPIDNSNLITANPFRNVRTLTGEGGHLKRDTPLVQNHDFELVPKSLWKALNRW
YGDNLPLPRQVIQPPNSDVELELYPLNLRILLHQAQPSQTGVGGGTQLGSWGSTVSGGYG
VLASGGGYAAIAVSSVLQPPKRYLAYTAAFSRLATVRQVGEFLCEQLRLKSEDIRLWHVP
QLDNGAILLEEDAMCLKELLIRDNDQLLLEIRNKDLTWPEELGSLATAQCGQGAGTPGDR
RRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKL
GTKGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDAL
HEDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCG
HESVRFDPFSLLSLPLPVENYIYFEVLVILLDGSVPIKYGFRLNSDCKYSHLKHKLSTMC
SLPPNLMLVCELWNSQIRQVLNDDEKLRTQSAKELYVYQLPEQSMRTRSNSGLSMHIEQG
LKDIQRSSALITSAQDSLSSLSTLQTSSHRASSRVLCNGHVSGLDVEGEAEVGTDVSQCN
SNSNYNPIVSTYSGNGSGDNQVHELLPDEAGKVSRCFGKRECMPHSLFCFKESLILSSSP
ENTFMHGAAAQQKRVSSAKLLHTESNTSSMSYTNHSGENSMESSLTEPIPLADLEPVSSR
NGSGGEDCSYRTSPNDSSGLSTGHTLGASLDVDEQAEEGNAEDHDQPDQITTSQPETSSG
VYSRRSSQPPHKAGKYLVAVHRKITRHDSYFLSYHKTRPSLFGVPLLIPNSEGGTHKDLY
CAVWLQVSRLLSPLPATTEQANHAADCDDSLGYDFPFTLRAVKADGLTCAICPWSSFCRG
CEIRCNNDYVLQGALPPINAAASNTSTPKMNAKFPSLPNLEAKRTPEYTASLSYTPTTKY
FEDFTIAIDWDPTALHLRYQSTLERLWVDHETIAISRREQVEPVDLNHCLRAFTSEEKLE
QWYHCSHCKGKKPATKKLQIWKLPPILIVHLKRFNCVNGKWVKSQKVVHFPFDDFDPTPY
LASVPQETILRHKELLELKNDAEMTMATNEVVSELDEIDAPSKEVKEELPNQTGSTKATA
SPPPTGNILRQSKTKNAVRRQRLISTSLTKTPIVDGEFEDYHQHRLKPDVDQFDPRYRLY
AVVSHSGMLNGGHYISYASNATGSWYCYNDSSCREISQKPVIDPSAAYLLFYERKGLDYE
PYLPNIEGRTLPNTASVPLEVDETEGELKKLCSIS
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
atgttatatgccgcctgtggtggcacccagcgtggcatctcctttaacgacctgctctgc
ggtctggtcttgataactcgtggtacccaagcggagaaaaccaaattcctgtggaacctg
tactgcaacgatgccggcaccttcatcatcaagtcggactatgtgcgcaacgtcaatctg
gctcccttcgagagcgtctccctattcgctcaaagcgaacgcgtcaatttcgagcagttc
caggactggatcataaagcatcgcaatgccactgtcctctccaaatggcttctgtccgac
aactgtgttagcctcacatcggagctggagacgccaacgttttaccagagcctcgctgga
gtgacgcatcttgaggagaaggacattggcgatttggaaaaggagttttggcgtttgaaa
aacacttcccaaaatggccaaatcgacttgcagttcctgggacccctgatcagtccaccc
ataccaaagaatgctctagcaggtctattcaacgcctttgatgagaaccgcgacggacac
atcgactttaaggagctgtgttgcggagtaagtgccgcctgccgaggaccgggtgtggaa
aggacacgattttgcttcaaaatcttcgatgtggatcgagatggcgttcttagccacgat
gaaacactgcagatgatcaatgttctgctattagtagccaaggaaaatcaggagtcccag
caatacaaggatctgaccaaacagctggtgataagtgatcttctggagtttggacagaga
agaagtccggatggaacgcctagtaagctaacccgagacaatgtctcgctgaccgctgag
gattttatgctgtggaccgtacagtgtgatctaagactcatgcagcccttgctggacctc
atcttcgagctgtgccacatcgtctttggcctgtggccccagtgcaagcacatggagaac
gatatcgtccggggatggttgcgacgggaggagcgcaggccgtaccgcgttggacagttt
tggtacttgatcacgcatgactggtggctcagttggatgcaatacactcagcacacgacg
cacacctgcgactattgcaagcgaaccgccagccagcggaccgctgttgatgaggcgctc
gtctgcgatgagagctttaacacccacagcttggaacagcacgatagctactccctgggt
tctggcacgggatcggcttccggttccgggtcggcgagtagtggcatctcagctggacga
cattgcggacccgtgcgaccagggcctattgacaacagcaatctgatcaccgccaatccg
ttccggaatgttcgaactctcaccggcgagggtggtcacctcaagcgggacacacccctg
gtgcagaaccacgactttgaactggtgcccaagtcactgtggaaggcattgaatcgatgg
tatggcgataatcttccactgccacgacaggtcatccaaccgcccaactccgatgtggaa
ctggagctatacccgctgaacctgcgaatcctgctccaccaggcgcagccatcccagaca
ggcgtaggcggaggcactcaacttggtagttggggctccacggtgagcggtggctacgga
gtgcttgcctccggtggcggatatgccgccatcgctgtaagcagtgtactccaaccgccg
aagcgatacttggcctacacggctgccttcagccgactggccacggtgcgtcaggtgggc
gagtttttgtgcgagcaactgcgtcttaagtcagaagatatccggctatggcacgttcca
cagctggacaacggtgccatattgctagaagaggatgccatgtgcctgaaagagttgctc
attcgggacaacgaccagctgttgctggaaatccgcaacaaagatttgacctggccggag
gaacttggctccttggccaccgctcaatgtggccagggtgcgggaacaccgggggaccgg
cgtcgcttaacacgcagttcaattatgtcggtacatgcgcccggagctacaggcctgcac
aacctgggcaacacctgcttcatgaacgccgctctccaggtgctgtttaatacccaacca
ctggcacaatactttcagcgtgagatgcatcgcttcgaggtgaacgcggccaacaaactg
ggcacaaagggtcagctagccatgcgctatgcggagctgctcaaggaggtttggacggcc
acgactagatctgtggccccgctgaagctacgcttttgtgtcaacaagtatgcgccgcag
ttcgccggtggaggtcagcacgattcccaggagctgctcgagtggctgttggacgctctg
catgaggaccttaaccgtgtgatggagaaaccgtacagcgagctgaaggactcgaatggg
cgcccagacaaaatagtggccgccgaggcctggtcccagcaccacgcccgaaaccagtca
attatcattgatctgttctacggccagttgaaatccaaggtcagctgtctgggttgtgga
cacgaatcggtgcgattcgatccgtttagtctgctcagtttgccgcttccggtagagaat
tatatctactttgaggtcttggttattctgttggatggaagcgttccaatcaaatatggt
tttcgtctgaactccgattgcaagtactcgcacctgaaacacaagttgtccaccatgtgc
tccctgcctccaaatctaatgctcgtctgcgagctatggaactcacaaatacgccaggtg
ctaaacgacgacgagaaactgcggacgcagagtgccaaggagctgtacgtctatcagctg
ccggaacaaagtatgcgaacacgatccaactcagggcttagcatgcacatcgagcagggt
cttaaggacatacagcgcagttccgctctcatcacgagcgcccaggactcgctgtcctcg
ctgagcactttgcagacgtccagccaccgcgcctcgtcacgagtcctgtgcaacggacac
gtttcgggcctggatgtcgaaggcgaggcggaggtgggcacggatgtgtcgcaatgtaac
agcaacagcaattacaatcctattgtaagcacttacagcggaaacggaagcggggacaac
caggtgcacgaactgctgccagatgaggccggaaaggtaagccggtgctttggaaagaga
gagtgcatgccccacagcctattttgcttcaaggagtcgctaattctgagctccagcccg
gagaacacatttatgcacggcgctgccgcccaacagaagcgcgtatcgtccgccaagctg
ctgcacacggagagtaataccagctccatgtcctacacgaatcattccggcgaaaattcc
atggagagctcgctgaccgaacccattccattggcggacctggagccggttagcagccgt
aatggcagtggcggcgaggactgctcctaccggacgtcgccaaacgattccagtggcctc
agcacgggccacaccctgggcgccagtttggacgtggacgagcaggcggaagagggcaac
gcggaggatcacgatcagccggatcagatcacaacctcgcagccggagaccagtagcggg
gtctactctcgtcgctcctcccagccgccgcacaaggcgggcaagtatttggtagccgta
catcgaaagataacgcggcatgacagctacttcctgtcctaccacaagacgagaccaagt
ctctttggcgttccgctgctcattccaaacagcgagggtggcacccacaaggatctttac
tgcgccgtgtggctgcaggtgagcaggctactcagcccattgcctgccaccacggaacag
gcgaatcatgccgccgattgtgatgacagcctgggctacgatttccccttcacgttgcgt
gccgtcaaggcagatggtctaacctgcgctatttgcccttggtcaagcttctgtcgcgga
tgcgagattcgatgcaacaatgattatgtactccagggagccctgccgcccatcaatgcc
gccgccagtaatacatcaacgccaaaaatgaatgctaaattcccatcgctaccaaatctg
gaggctaaacggacgccggaatataccgcctccttgtcgtacacaccgacaaccaaatac
tttgaagacttcaccattgccatcgactgggatccgaccgccctgcacttgcgctaccaa
agcaccttggagcgtctgtgggtggatcacgagaccattgccataagtcggcgggagcaa
gtggagcccgtagacctgaatcattgcctgcgcgccttcacctcggaggagaaactggag
cagtggtatcactgcagtcattgcaagggcaaaaaacccgccaccaagaagctccagatc
tggaagctacctccgatattgattgttcacttgaagcggtttaactgcgtcaacggcaaa
tgggtgaagtcacagaaagtggtccactttcctttcgatgacttcgatcctactccgtat
ctggcctcagtccctcaggagacgatactgcggcacaaggagctgctggagctaaagaat
gatgcagaaatgacgatggcaactaacgaagttgttagcgaattggacgagattgatgca
cccagtaaggaggttaaggaagaactacccaatcaaacggggtccacaaaggctacggcg
tcgccaccgcccacagggaatattctgcgccagagcaagaccaaaaatgctgtccggcga
caacgcctcatctctacgagtctcacaaaaacgcctatcgttgatggcgagttcgaagac
tatcaccaacaccgacttaaaccagatgtggatcagttcgatcccagataccgactctat
gctgttgtgtctcactcgggcatgctgaacggaggtcactacatttcctatgcttcgaat
gcaactggttcctggtactgctataacgacagctcctgccgcgaaatatcccagaagccg
gtcatcgatccaagtgctgcatatctgctgttctacgaacgcaagggcctggactacgag
ccttacctaccgaacatcgagggacggacgctgcccaataccgccagtgtgccactcgag
gtggacgagaccgagggagagctgaagaagctgtgctcaatttcctaa

DBGET integrated database retrieval system