KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8445Help
Entry
Dmel_CG8445       CDS       T00030                                 

Gene name
calypso
Definition
CG8445 gene product from transcript CG8445-RB
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG8445 (calypso)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dmel_CG8445 (calypso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:52F7-52F7
AA seq 471 aa AA seqDB search
MNAAGGGSGAQAAAVAAGNNSLSHNALLSTASGATTMPMAQLADGWLELESDPGLFTLLL
KDFGCHDVQVEEVYDLQKPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSI
FFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKTHTKGMSPENKGLAIGNTPELA
CAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGW
EDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTL
QKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADEND
RRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQHLLPSKKVSGQGAANRISKQS
TTASAGGSTAAGTASTPKTQQQQAAAAKNGKSPSKTPGRRRKGRNKCRKRK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgctggaggaggtagtggtgcccaggcggccgcagtggcggcaggcaacaac
agtctcagccacaatgcgctactttccacggcctcaggagccaccaccatgcctatggcc
caactggcagacggttggttggagctggagtccgacccaggtctcttcacactgcttctc
aaggattttggatgtcacgatgtacaggtggaggaggtgtacgacctacagaaacccatc
gagagtccatatggcttcatatttctcttccgctggatcgaagagcgacgcgccagacgc
aaaattgtggagacaactgctgagatattcgtcaaggatgaggaggccatttccagcatt
ttcttcgcccagcaggtagtccccaatagctgtgccacacacgcgttgctttcggtgctc
ctgaactgcaacgagaacaatcttcagctgggcgacaccctgagtcgactaaaaacccac
accaaaggcatgagtccggagaacaaggggctggctattggcaacactccggagctggcc
tgtgcccataactcacacgcaatgccgcaggctcggcgccgtctagaaaggacgggagcg
ggcgtctcaagttgccgcttcacgggtgaggcgtttcacttcgttagctttgtgcctatc
aatggacaactgtttgagctggatggcttgaaaccgtatcccatgaatcacggcggttgg
gaggatagcgaggattggacagataagttccgacgtgtgatggctgagcgactgggaata
gcgaccggcgaacaggacatacgtttcaatctcatggccgtagtgccagacaggcggatt
gccataacacataaacttaagatgctgcgcacaaaccaggcaatcgtgtccggaacactg
cagaaacttctaaaggccgacgagcagggcgaatcggggaacggagactcacaacgtccg
gatacacccaccacattattggagccgagcgctttcaccgcacgtgacctgcaatcgctt
ctcaagaacctggacacagaaatagccatcaatgagcagcatctggctgacgaaaacgat
cggaggcacatgtttaaggtggacgccagtcgacgtacccacaactacgataagttcatt
tgcactttcctctctatgctggcccaccagggcgtcctgggcgagctggttagccagcat
ttgcttccgtcgaagaaggtcagtggccagggtgctgccaatcggatcagcaagcagagc
accaccgccagtgcaggcggaagcaccgcagcaggcactgcatccacgcccaagactcag
caacagcaggctgcggccgctaagaatggcaagtcgccaagcaaaacgccaggcaggagg
cgaaagggacgcaacaagtgcagaaaacggaagtag

DBGET integrated database retrieval system