KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8492Help
Entry
Dmel_CG8492       CDS       T00030                                 

Definition
CG8492 gene product from transcript CG8492-RD (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dmel_CG8492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:66A11-66A11
AA seq 1360 aa AA seqDB search
MLRWPVVCLLLPLLATAKIFDRCELANLLQHRFGLPAAQVATLVCIAQHSSDFNTAAFGG
GVGLGGGSHGLFQISDVYWCSPPGQGKGCGLSCSRLRDDDIADDVLCVRKIYAEHQRISG
DGFTAWQAYDAYCRQDANSYVAGCGGPGSSALSVAASYHKPQQVQVHSYPVQQYHQVAQI
QPQGKIYSRCELAQELYYQHKLPMPQIPTWVCIAQHESSFNTAAVGRLNADGSADHGLFQ
ISDLFWCTHEQRAGKGCHATCNQFLDSSIGDDVQCIRRIHQEHTQISGDGFNAWTVYKRN
CLNQHYEQIAACFAKPPAHQPQHHPNAIAGGPVKSKVSYAYQYGQVQVHQTPIAPAVNQY
YRPPQPSPVLSYQTNVAAYSGNPFLRPRPVNPPRQHPNAIGVPLKNQTPANPFYIHKQQT
QYQPQYQTHFQTHYQRTGKVYNRCELAQELYFSHKFPMQDLATWVCIAEHESSFNTTAVG
RLNADGSADHGLFQISDLYWCTHNDGGGKGCHIDCNRLLDSDITDDVKCVRTIHEEHTRI
SGDGFTAWTVYNGHCRQKTRADVANCFDGKDLPAEVAKPSKGNELVKKTSPTPKAKIYNR
CELAKELYHRHKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISDIYWCTH
DQTSGKACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNLAKL
SDCFDGNEISEADKTSHYGERPQVMPHQSVPQKPQHKTATIQEYAGNPFLQNLQAAKPPQ
PTLNKNKLTNNVVAPKEQKTNKLYATNPFFNGQVQSKPPPTQGAPVYSTKKPNYDHNPFL
KAPGSVTPSVKPSHASQEVKLHDSTSYAQNPFLSLLGKPIVPAQAPIKPQSKPPSPSKST
QLVSRPYVSSDSFRNEVIKFTATSAAVATTASFTKQSVTTTTRKPQTASTTKPVSTTAKT
TSLPLWSWQTSTTAKPTISESGNRYTTSTTRSVITNKPNTHPTIAAVSRPTTRATTRSTN
GPIRTTSQPGTYLNTPLSSRSPIRQSTIRSSTVFTTRSTTRPTIRSTTHAISRPTSSPTT
RPTTRLTTRPTTRTTTRASVSPTTRPTVGLTTYQPTRTPTSITRRPIYTTQKQYTTTTRA
TTPYPTVSKPTTRPSTTTRPLTTTRYIPTTRQSVITQTTNRNSAIYLPRNNTISTNRSTT
KSPYHYVSINKPTTRSTTSTRPSTTIRYSPTTRQPPTTRSTTRYSAITAFSTRQTSTTPR
PYLFTSTTKKSVTTKDPFDHPFFQKFKAKFEKTTTTTNQKASTLAVNQNQTTISPYYAKY
QENKVKTGAKTVLSYDFGQNRNTTSRPKSAFDVYLNWNKN
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggtggccagtggtttgcctactgctcccgcttttggccacggccaagatcttc
gatcgctgtgagttggccaatttgctgcagcaccgttttgggcttcctgccgcccaagtg
gccaccttggtgtgcattgcccagcattcgagtgatttcaatacggctgcctttggcggt
ggcgttggattgggcggtggttcccatggtctctttcagatcagcgatgtctactggtgc
tcgccaccgggccaaggaaagggttgtggtctgagttgttcgagattgcgggacgatgac
atcgccgacgatgtcctgtgtgttagaaaaatctatgcggagcatcagaggatcagtggc
gatggattcacggcttggcaggcttatgatgcttattgtcggcaggatgcaaattcgtat
gtggcaggatgtggaggtcctggcagcagcgctctttcagtagctgcgtcctaccataaa
ccgcaacaggttcaggttcacagctatccagtgcaacagtaccatcaggtggctcaaatc
cagccacagggaaaaatctacagtcgctgcgaattggcccaggaactgtattaccaacat
aagctacccatgccgcagattcccacctgggtgtgcatagcccagcatgaatcgtccttc
aacacagctgccgtgggtcgactgaatgcagatggcagtgcggatcatggtctgttccag
atcagcgatcttttctggtgcacccatgaacagagagctggaaaaggatgtcatgccaca
tgcaatcagttcctcgactccagcataggcgatgatgtgcagtgcattaggcggatacac
caggagcacactcagatctcgggagatggcttcaatgcctggactgtgtacaaacggaat
tgcctaaaccagcactacgaacagattgcagcctgttttgccaagccaccggctcatcag
cctcagcatcatccaaatgccattgcaggaggtcctgtcaaatcgaaggtcagctatgcc
tatcaatatggccaggttcaagtacaccagacgccaattgctcctgccgtaaatcaatat
tatcgcccgccgcagccgtcgcccgttttgagttaccaaaccaatgtggctgcctattcg
ggcaatcccttcctgcgaccacgcccagttaatcctcccagacaacatcccaatgccatt
ggagtaccccttaaaaaccaaacccctgccaacccattctatattcacaaacagcaaaca
cagtatcaaccacaatatcagacacactttcaaacacactatcaacgcacgggtaaagtt
tacaatcgctgcgagttagcccaagagttgtatttctcacacaagtttcccatgcaggat
ttggccacctgggtgtgcatcgccgagcatgaatcctcattcaatacgactgctgtgggt
cgtctgaatgcggacggcagtgctgatcacgggctcttccagatcagcgatctctattgg
tgcacacacaatgatggtggcggcaagggatgtcacatcgactgcaaccgcctgctggac
tcggacatcacggatgatgtcaagtgcgttaggaccattcacgaggagcacaccagaatc
tcgggagatggattcactgcctggactgtctacaatggacactgcaggcagaaaactaga
gccgatgttgccaactgttttgatggtaaagatctgcctgcggaagtcgcgaaaccatcc
aagggtaacgaactggttaagaagacatctccaactccgaaggcaaaaatatacaatcgc
tgtgagctggccaaggaactataccatagacacaagtttcccatgagggagattcccaca
tgggtgtgcatagccgaacatgaatcctcttttaatacagcagctgtgggcaaactgaat
gcagatggcagcgaggatcacggcctgtttcaaataagcgatatttactggtgtacccat
gatcagacaagtggtaaggcctgtcacattgaatgcgatcgtttgctggattcggatata
tccgatgatgtgcagtgcatacgcactattcacgaagaacacacacgactctcgggagat
ggattcaatgcctggactgtctacaatggacattgcaggaatcaaaacttggcaaaatta
agtgactgctttgatggaaatgagatttcagaggcggataaaaccagtcattatggtgag
aggccccaggttatgcctcatcaatcagtgccacagaaaccacaacacaagacagcaact
attcaggaatatgctgggaatccctttttgcaaaacctacaagcagccaagccacctcag
cccaccttaaataaaaataaactaacgaataatgtagtagctcccaaggagcaaaaaaca
aataaactatatgccaccaatccatttttcaatggtcaagtccagagcaaacctcctccc
acacaaggagcacctgtttattctaccaaaaaaccgaactatgatcacaatcccttcctg
aaagcccctggttcagtaacgccatctgttaaaccttcacatgcttcacaagaagtcaaa
ctccatgacagtacatcctatgcccaaaacccattcctcagtttacttggcaaaccaatt
gtacctgctcaagcacccatcaagccccagtccaagcccccgagcccatctaagtccact
cagctggtcagcagaccctatgtcagcagcgacagtttccgcaatgaggtgattaaattt
acggccacctctgcagcggtagcaacaacagcaagctttacaaagcaatctgtaacaaca
accacacggaaacctcagacagcgtctacaacaaaacctgtctcaactacggccaaaaca
actagcttgccgttatggtcatggcaaacttccacgaccgctaagcccacaatatcagaa
agtggtaatcgctatacaacttcaaccactcgatcggtgataaccaataagcctaatact
catccaaccattgcggcagtttcacgtccaactactcgggccactacccggtcaactaat
gggccaattcgcaccacatctcaaccagggacctaccttaacactccactatcaagtcgt
tcgcccattcgacaatctacaatccgttccagtactgtatttacgactcgttcaacaact
cgcccaactattcggagcactactcacgcaattagtcgcccaactagtagtccaactact
cgtccaactacccgtctaactacccgcccaactactcgtacaactactcgtgcatctgtt
tccccaactactcgtccaactgtaggtttgactacttaccaacctactcgtacaccaact
tcaatcacccgacgcccaatttatacaactcaaaaacaatatacaacaacaacaagagca
acaacaccgtatccaacagtaagcaaacccacaactcggccttccacaacaactcgacca
cttacaaccactcgatatattccaacaacccgccaatctgtaataacacagaccacaaat
cgaaactcggcaatatatttaccaagaaataatacaatttcgacaaatcgttcaacaact
aagtctccatatcattatgtatccataaataagcctaccacacgctcaactacaagcact
cgtccaagcacaacgattcgttactcaccaacaactcggcaaccgcccacgacaagatcc
accactcgttattcagcgataacggcattttcaactcgtcaaacaagcaccacaccaagg
ccatacttatttacctcaacgacgaagaaaagtgtcaccactaaagatcccttcgaccat
ccatttttccagaaattcaaggctaagtttgagaaaaccacaacaacaacaaatcaaaaa
gcttccacattagctgtaaatcaaaatcaaactaccattagtccatattatgcaaaatat
caggaaaacaaggttaaaacgggagcaaaaaccgtgctttcttacgactttggtcaaaat
aggaacactacaagtaggccaaaaagtgcctttgatgtatacctgaattggaacaaaaac
taa

DBGET integrated database retrieval system