KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8556Help
Entry
Dmel_CG8556       CDS       T00030                                 

Gene name
Rac2
Definition
(RefSeq) Rac2, isoform B
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04145  Phagosome
dme04310  Wnt signaling pathway
dme04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG8556 (Rac2)
   04310 Wnt signaling pathway
    Dmel_CG8556 (Rac2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    Dmel_CG8556 (Rac2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG8556 (Rac2)
Membrane trafficking [BR:dme04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    Dmel_CG8556 (Rac2)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    Dmel_CG8556 (Rac2)
  Phagocytosis
   NADPH oxidase complex
    Dmel_CG8556 (Rac2)
  Macropinocytosis
   Ras GTPases
    Dmel_CG8556 (Rac2)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    Dmel_CG8556 (Rac2)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG8556 (Rac2)
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG8556 (Rac2)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG8556 (Rac2)
  Exosomal proteins of bladder cancer cells
   Dmel_CG8556 (Rac2)
GTP-binding proteins [BR:dme04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    Dmel_CG8556 (Rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 38831
NCBI-ProteinID: NP_001261517
FlyBase: FBgn0014011
UniProt: P48554 M9PBU2
Position
3L
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLR
DDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPV
VRGPKRHKCALL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggttgtgggcgacggagcggtgggaaagacctgtctgctg
atcagctatacgaccaacgccttccccggcgagtacatacccacggtgttcgacaactat
tcggcgaatgtgatggtggatgccaagcccatcaatctgggcctctgggatacggctgga
caggaggactacgatcgcctgaggccgctatcctatccgcaaacggatgtctttctcatc
tgtttctcactggtgaatccggcatcgtttgagaatgtgcgagccaaatggtttcccgag
gtgcgtcatcattgcccgagtgtgccgataatcctggtcggcaccaaactggatctgcgc
gacgataagcagacgatcgagaagctgaaggacaagaagctaacaccgatcacctatccc
caaggactggcgatggccaaggaaatagctgcggtcaagtatctggagtgctcggccctg
acccaaaagggtctgaagacggtcttcgacgaggccatacgatccgtgctatgtcctgtc
gttcgaggacccaagcggcacaagtgcgccctgctctaa

DBGET integrated database retrieval system