KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8610Help
Entry
Dmel_CG8610       CDS       T00030                                 

Gene name
Cdc27
Definition
Cell division cycle 27 ortholog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG8610 (Cdc27)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dmel_CG8610 (Cdc27)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dmel_CG8610 (Cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:65E9-65E9
AA seq 900 aa AA seqDB search
MMIQEPVQAAIWHCLNYYDFKDAVFLSERLCSEVESDETIFLLATSYFRSNQVHQAYWLL
KEKARRSPQCRFLQAKCAYELKKYAEAESALISTGFADAKNCDELQRDFGDLACFAYQLM
AQICMRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAAAIFQIHSTDVFNTCQG
SSVNANAMVLFGAEQQGQQHQERQSLITNLSNVSNYILTTPVDQQQQQINQNQNQHHNSN
MVTPINNNNNNNNLNSSISMLRGGLVQNSSMLAMLEDTPMGAPQDPAGQYQQNQQLYDMS
SGTPFRKQFKYLSAISPPTPSFGIMPLTSPCTGNDGSFIGNHTPVMNISYSPMPQMLVEV
NQEPKMMGKKLKTHVGGLINRKEGSLNKPAVFTQAGNITPRTPNNNNVGNNGNMNVPPNP
NAAVRRSSRLFSNSYSVKENNKSPNIANKFVQPRSPPRKAKSRMTKICLNNELIEDKSHH
LSEKRKEKVETITSSGANNNSGGRSAAEEAKVLLNNSLNNAQTMAHQLMGLKKQSADGLM
ALLRGLAEAYQLLSNFQCKAAIKQLETTIPKHHLNSSWVQSLIGLARYEMREYEAAVAIF
ETIHKTEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQDKTSPVTWCVSGNCFSLQKE
HETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFDKAMDYFRAAVVRDPRHYNAWYGIG
TIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQTLNTAATLDPKN
PLTRFHRGSIYFSLGKYQEALRELEELKEVVPKESVVFYLIGKIHKTLGNMDLALMHFSW
ATDLDPKGANNQIKDAFDSMAHPSCCPANTTALDVDLEPTSERSDDSTQAQQDGSYDSDY
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaagagcccgtgcaggccgccatatggcattgcctgaactactacgacttc
aaggatgccgttttcctgtcggaacgcctgtgctcagaagtggagagcgacgagacgata
ttcctgctggccaccagctacttccgctccaatcaggtgcaccaggcatattggctgctc
aaggagaaggcacgccgctcgccgcagtgccgctttctgcaggccaaatgtgcctacgag
ctgaaaaaatacgctgaggcggagagtgccctgatctccacgggattcgcggacgccaag
aactgcgatgagctgcagcgggacttcggggatctggcctgcttcgcctatcagctaatg
gcccagatctgcatgaggaccgagcgcaataaactggccgttagtgctttaaggcgcgcc
ctcaaactgaaccccttcatgtggcacgcattcgcggatctgtgcctgctgggccaggat
acagatgcggcggccatattccaaatccacagcacagatgtgttcaatacctgccagggc
agcagcgtaaatgccaatgcaatggtgctgttcggagccgagcagcagggtcaacagcat
caggagcgccagtcgctgatcaccaacctaagcaatgtctccaactacattctgaccacg
cccgtggatcagcagcaacaacagatcaaccagaatcagaaccagcaccacaacagcaac
atggtgacgcccatcaacaataataataataacaacaatctcaatagttcgatcagcatg
ctgcgcgggggtttggtacaaaactccagcatgctggcgatgctggaggacacacctatg
ggagctccgcaggacccggccggccagtatcagcagaaccagcagctctacgacatgagc
agcggtactccgtttcgcaaacagttcaaatacctatcggccatctcaccgccaacaccg
agcttcggcatcatgcctttaactagtccgtgcaccggcaacgatggatccttcattggc
aaccacacgcccgttatgaatataagctattcgccgatgccacagatgttggtcgaggtc
aaccaggagccgaagatgatgggcaaaaagctaaagacacatgtgggcggactcatcaat
cgcaaagagggcagccttaataaacccgccgtctttacgcaagccggaaacataacgccc
cgcactccgaacaacaataatgtgggcaacaatggcaatatgaatgtgccgcccaatccg
aatgctgcagtgcgtcgcagttcgcggctgttcagcaactcgtattcggtgaaggagaac
aataaatcgcccaacatagccaacaagttcgtgcagccacgttcgccgccccgcaaagcc
aagtcacggatgaccaagatctgcctaaataacgaactgatcgaggataagtcccaccac
ctctccgagaagcgcaaggagaaggtggagactattacttcctcgggagcgaataacaac
agcggtggacgcagtgccgccgaggaggccaaagtactgctgaacaatagcctaaacaat
gcccagacgatggcccaccagctgatgggactcaagaaacaatcggccgatgggctgatg
gccctgctgcggggtttagctgaagcctatcagctgctctcgaacttccagtgcaaggcg
gccataaagcagctggagacgacgataccaaagcaccacctgaactccagctgggtgcag
tcgctcatcggactggccaggtacgagatgcgtgagtatgaggcggcggtggcgatattt
gagaccatccacaagacagagccatgtcgcttggactacatggagatatactcgtcatcc
ctgtggcatttgcagcgcgaggttgagctgtcagctctcgcccaggatctgattaaccag
gacaaaaccagcccggttacctggtgtgtgtccggcaattgcttttcgctgcaaaaggag
cacgaaaccgcgatcaagttcttcaagcgggctgtccaagtggatccagacttcgtctac
agctacacactgttgggccacgaactcgtactcaccgaagaatttgataaggccatggac
tacttccgtgcagcagtggttagagatccgcggcattacaatgcttggtacggcatcggc
accatctactccaagcaggagaaatacgagctggctgagattcactacgtgaaggcgctg
aaaatcaatccacagaactcggttattctcgtgcacatcggcgccatgcaattctacatg
aagaagaaggatctgtcgctgcagacgctaaacacggccgccacgctggaccccaagaac
ccgctgacgcgattccatcgcggctccatctacttctcgctgggcaagtaccaggaggcg
ctgcgcgaactggaggagctcaaggaagtcgtgcccaaggagtcggtggtgttctatctg
atcggcaaaatccacaagacgctcggcaacatggatctggcgctgatgcacttcagctgg
gccaccgacctagatcccaaaggtgccaacaatcaaatcaaagatgccttcgactcaatg
gctcatcccagctgctgtccggccaacactacggccctggacgttgatctggagcccact
tcggagcgttccgatgactcgacgcaggcgcagcaggacggaagctacgacagcgactac
tag

DBGET integrated database retrieval system