KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8630Help
Entry
Dmel_CG8630       CDS       T00030                                 

Definition
CG8630 gene product from transcript CG8630-RA (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dme01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dme01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:87E3-87E4
AA seq 408 aa AA seqDB search
MSPNIIGSTFILAETAIADGNNNKMAATPAASAAPSAATPSQKVAKKAEAKTPENKPYEL
EIVWRNVGLFVILHSMALYGLYLVFAESAYWELLPVYATMFLGGLGITAGVHRLWSHKAY
KAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCK
KHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFT
CSMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDY
KAAELGTYSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLRTGDGSHIAALLDANNNS
AIPTSELVAHLDHEKEEHAIWGWDDKDISEEDRKGANVVNKESECKLD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaacataataggcagtacctttatattggccgagacggccattgccgatggc
aacaacaacaaaatggctgccacaccagctgcttccgccgccccttcagcagccacgccc
agccagaaggtggccaagaaagcggaggccaagacgcccgagaacaagccctacgaactg
gagatcgtctggcgcaacgtgggactcttcgtcatcctccactcgatggccctgtacggt
ctgtacttggtgttcgccgagagtgcctattgggaactcttgccagtctatgccaccatg
ttcctcggcggtctgggcatcacggccggagtgcatcgtctgtggtcgcacaaggcctac
aaggccaagctgccactgcgcatcttcctcatgctgtgccagtcactggccttccagaac
agcatctgggagtggacccgtgaccaccgcgtgcatcacaagttcaccgacacacacgcc
gatccccacaactcccgacgaggcttcttcttcgctcatatgggctggctgatgtgcaag
aagcaccccgatgtgaccagcaagggcaagcagatctccatggaggatattgagcaggat
cccgtcgttatgttccagaagaaaatgtactttgtggttatgcccatctgctgcttcgcc
ctgcccatgatcttcccctactacgtgatgggcagctcgctgcgcgtctgcttcttcacc
tgctccatgctgcgcttctgcctgtcgctgcacttcacgtggctggtaaacagcgccgcc
cacttctacggcatgaagccctacgatgtcaatgtgagcgccatgaacaacaagctggta
tccaccctgaccatcggcgagggatggcacaactaccaccacgtcttcccctgggattac
aaggcagccgagctgggcacctacagtttcaactggacgacggcctttatcgatgtgatg
gctaagatcggacaagcctatgacctgaagttcgtctcgcaggagatggtctacaagcga
gtccttcgcactggcgatggctcccacattgccgccctgctggatgccaacaacaatagt
gccattccgaccagcgagctggtggcccacctggatcacgagaaggaggagcatgccatt
tggggatgggacgacaaggatatcagcgaggaggatcgcaagggagccaatgtggtgaac
aaggaatccgaatgcaagctggattag

DBGET integrated database retrieval system