KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8665Help
Entry
Dmel_CG8665       CDS       T00030                                 

Definition
CG8665 gene product from transcript CG8665-RA (EC:1.2.1.- 1.5.1.6 2.1.1.- 2.1.2.-)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dmel_CG8665
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dmel_CG8665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:39D2-39D2
AA seq 913 aa AA seqDB search
MALKMRIAIIGQSNFAADVLELLLDRSNIQIVGVFTIPDKGSREDILATTATIHNIPVFK
FACWRRKGVALPEVLEQYKSVGATLNVLPFCSQFIPMEVINGALLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNVESTDTLDTIYKRFLYPEGVKA
MGVAVDMVASGTAPKIIQPEVGATYDPAMFKTENQVINLQATAEKIWNFVRGLDSVPGAI
ATVLHGNGTEEQIRLFGAHLYSAGPVSNGKVLRLRGLTKTAWIHSGGLLIEGTDGAFVNI
RRIKRGTKVISASEWFKQAEDQSITDFSEDELVKRSLLAGIWKAILKEDVESSTDFFASG
AGSMDVVRLVEEVKEAFDVPLQNEQVFMAPVFEEFFSLLVRFLRQGSAGFGNQQLDFEAF
TLKANKREIRVPTQLFINGEFVDAEAQRTLEIVNPTNEEVLCKVACASATDVDKAVRAAH
SAFYGSWRQITPRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSDAGQAVADHELVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDMDKAVKHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGA
KLVYGGCRVPNLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDIDSLMQRANR
TEYGLASGVFTKDIGKALNFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEAL
NEYLKTKCVTVEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaaatgagaatcgcaattataggacagagcaattttgctgctgatgttctg
gagcttctgttggatcgctcaaatatccaaattgtaggagtcttcactattccagataaa
ggcagtcgagaggatattttggctactactgctaccatccacaatatacctgtttttaag
ttcgcatgctggcgtcgcaagggcgtggcactacctgaggtcttggaacaatacaagtcc
gtgggggctaccctgaatgtgttgcccttctgttctcaattcattcccatggaggtgatt
aacggggcgctattgggcagcatttgttaccacccttctatcctcccacgtcaccgcgga
gcgagtgccatatcgtggacactgatcgagggggacgaggtggccggcttcagcatcttt
tgggcagatgacggtcttgacacaggacccctactgctaacccgacaaacaaacgtggaa
tccacggacactctggacaccatatacaagcgctttttgtaccccgaaggtgtgaaggcg
atgggcgtcgccgtggacatggtggctagtggtacagctcccaagataattcagccggaa
gtgggggcaacctacgacccggctatgtttaaaacagaaaatcaggttatcaatcttcag
gctacagcagaaaaaatttggaactttgttcgtggtctggactcagttcctggagccata
gcaacggttctgcacgggaatggcacagaggagcaaattcgactctttggtgctcatttg
tactctgctggccccgtgtcgaatggaaaggttcttcgtctaagaggcttaacaaagacc
gcctggatacacagcggtggtcttcttatagagggaacagacggtgcctttgtcaacatt
cgccgcattaagcgtggcacaaaggtaatcagtgccagcgagtggtttaagcaagctgag
gaccagtctatcactgacttcagcgaggacgaattggtaaagcgatcgttgctggctgga
atttggaaggcaatacttaaggaagatgtcgagtcatcgactgatttctttgcatccgga
gctggttcaatggacgtggtgcgcttagtcgaggaagttaaagaagcctttgacgtgccc
ctgcagaacgagcaagttttcatggcgcctgtgtttgaagagttctttagcctgctggtt
aggttccttcgacagggaagtgccggtttcggtaaccagcagctcgattttgaggcattc
acgctgaaagccaacaaaagagagattcgagtgcccacacaactttttatcaacggagag
tttgttgacgccgaggctcaacgcactttggaaattgtaaaccctactaatgaggaagtg
ctttgcaaagtggcatgcgcttcggccaccgacgtggacaaggcagtgcgagcagcgcat
tctgccttttatggatcttggaggcaaataacacccagacaacgaggccagttgatgctg
aacttggctgatctgatggaacgaaataaggaggagctggccacaattgagtcagtcgat
tcgggagcggtttacacgctagcccttaaaacccatgttggaatgtccatcgaagcgtgg
cgctactttgccggatggtgcgacaagatccagggcaacacaatccctgttaaccctgcg
agacccaacaacgtactgaccttcacccgtaaggagccaattggtgtatgcggtttaata
acgccttggaactaccccctgatgatgctttcctggaaaatggccgcctgcattgccgcc
gggaatacctgtctcataaagcctgctcagacctgtcccctgaccgctctaaagtttgca
gagctaactgtccgagccggattcccccccggcgttatcaatgtcctgcctggaaaaggt
tcagatgcaggccaggcagtggcagaccatgagctggtccgcaaactggggtttaccggg
tccacacccattggcaagcacattatgaagtcatgcgcagactccaaccttaaaaagtgc
tccctagagctgggcggcaagagcccgctaattatctttgcagattgtgatatggacaaa
gccgtcaaacacggcatgtcctcggtgttttttaataaaggagagaactgcatcgccgct
ggacggcttttcgtggaggatcggatacacgacgaatttatccgacgcgtccttaaggat
ttgcgcaccatgacaatcggggacccacttgaccgctcgacggcccacgggcctcagaac
cacaaggcgcactttgacaaactgctggagttttgtagacgtggggtcgacgagggcgca
aagctggtgtacggaggatgtcgagtcccaaacctcaagggatattttttcactcccaca
gtgtttacgaacgttacggacgatatgtttattgcccaagaggagtcctttggaccgatc
atgataatatccaagttcaatggcagcgacatagattcattgatgcagcgagctaatcgc
acagagtatggcctggccagtggcgtttttacaaaggatattggcaaagcgcttaacttt
gcggatcgcatcgaggccggcactgtgttcgtcaatgtatataataagactgatgtggct
gctccatttgggggctttaagcagagcggttatggcaaggacttgggtcaggaggcgctt
aacgagtatcttaagaccaagtgtgtcacagttgaatattag

  All links  
No link information was found.   
DBGET integrated database retrieval system