KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8808Help
Entry
Dmel_CG8808       CDS       T00030                                 

Gene name
Pdk
Definition
Pyruvate dehydrogenase kinase (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dmel_CG8808 (Pdk)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   Dmel_CG8808 (Pdk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:45D5-45D7
AA seq 422 aa AA seqDB search
MRLFPVRFSAASSSMASLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIR
NRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGG
NPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEIQQHSSEPGDNLPIRT
VYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIP
RSQTDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTD
AIIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQSSDMNARQLSATTPKRCDFLQ
DA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgtttccagtccgattctcagccgcctcctcgtcgatggcgagtttggccaaa
atgctcgacttttactcgggcttcaacccctcgcccctctcgataaagcagttcatggac
tttggtcagaatgcctgcgagaagaaatcgtacatattcctgcgcaaggaactgcctgtt
cgactggcgaatatcatgaaggagatcgcccttctgccggataacctgttgcacaccaga
tccgtaagcgaagttagttcctggtatgtcaagagtttcgaggatgtgctggtgtacgag
aaagcagagcccacccacgacaatctgcaaaagtttgtggccgatttggatctcattagg
aatcggcacaacgatgtggtgcaaacgatggcccagggtgtgatcgaaatgaaggagaac
gagggcggccaggtggatgcgcctacagagagttccattcagtactttctcgacaggctc
tacatgtctcgcatcagcattcgaatgctgataaatcagcacacccttctctttggcgga
aatccacatgcgggtggccgccatattggttgcctggatcccgcctgtgatctgtcggat
gtggttcgcgatgcttacgagaatgcgcgattcctatgcgatcagtactacctgaccagt
ccggcattggagatccagcagcacagcagcgagcctggagacaacctgcccatccgcacc
gtttacgtgccctcgcacctgtactacatgcttttcgagctcttcaagaactctatgcga
gctgttgtagagcaccatggccatgacaacaatgacacattgccccccttgaaagtagcc
atttgcaagggcaaggaggacatctgtgtgaaaatttctgaccagggaggcggcattccc
cgctcccagaccgatcagctcttcaagtatatgtacagcacagcgccgcagccctcgaag
tcggatctgcatacggtgccattagcgggctatggatacggtctgccgatctcaaggctt
tacgcccgctatttccatggcgacattgtgctgctctcctgcgaaggattcggaacagat
gcaatcatctatctaaaggctctgtccgacgaagcaaacgaattgctgccgatcttcaac
aagacaagctcaaagttctatcgcgccaccgtgcccacgggtgactggtccaatcagagc
tccgatatgaacgcacgccagttgtcggccaccacacccaagcgctgcgactttcttcag
gacgcatga

DBGET integrated database retrieval system