KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8824Help
Entry
Dmel_CG8824       CDS       T00030                                 

Gene name
fdl
Definition
fused lobes (EC:3.2.1.52 3.2.1.53)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dme00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dme00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dme00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dme00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dme00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dme04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:49A9-49A10
AA seq 673 aa AA seqDB search
MRYVYESLRYLYKMSLAVSLRRALLVLLTGAIFILTVLYWNQGVTKAQAYNEALERPHSH
HDASGFPIPVEKSWTYKCENDRCMRVGHHGKSAKRVSFISCSMTCGDVNIWPHPTQKFLL
SSQTHSFSVEDVQLHVDTAHREVRKQLQLAFDWFLKDLRLIQRLDYVGSSSEPTVSESSS
KSRHHADLEPAATLFGATFGVKKAGDLTSVQVKISVLKSGDLNFSLDNDETYQLSTQTEG
HRLQVEIIANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSR
HFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAVHGAYSESETYSEQDV
REVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQL
NPKNNYTYLILQRIYEELLQHTGPTDFFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQA
MARLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFS
HVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTE
QVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEAL
FPKYCAQNPGECI
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgtgtacgaaagcctacgctatctctataagatgtccttggctgtatcgctg
cgccgagctctgttggtgctgctcaccggcgccatattcatcctgacggtgctctactgg
aaccaaggagtcaccaaggcccaggcttacaatgaggcgctggaacgcccccacagccat
catgatgctagtggctttcccatacccgtcgagaagtcctggacgtacaagtgcgagaat
gaccgatgcatgcgagtgggccaccatggtaaatctgccaagagggtctcgttcataagc
tgttcgatgacgtgcggtgacgttaacatttggccgcaccccacccagaaattcctgctc
agctctcagacgcacagcttctccgtggaggatgtgcaactgcacgtagacacggcgcat
cgcgaagtacgcaagcagctccaactggcttttgactggttccttaaggatctcaggcta
atccagcggctggactacgtgggtagttcatcagagccgaccgtaagcgaatcctcttcg
aagtcacgccaccacgcggatttggaaccagctgccacgctctttggagctacctttggt
gtaaagaaggctggggatctaactagcgtacaggttaagattagcgtgctcaaatccggg
gatcttaactttagcctggacaatgacgagacctaccagcttagcacacaaaccgaagga
caccgcctgcaggttgagatcatcgcaaattcttacttcggagcccggcatggtctgtcc
acgctacagcaactgatatggtttgacgacgaagatcaccttttgcatacgtatgccaat
agtaaggtgaaggatgcgcccaagttccggtatcgaggcctcatgctggacacctctcgc
cacttcttctctgtggagtccatcaagcgtacgattgtgggcatgggcttggccaagatg
aaccgcttccactggcacctcacagatgcccagagttttccctacatttcgcgctactat
ccagagttggccgtgcacggagcttactcggagagcgaaacgtactcggagcaagatgtt
cgggaggtggccgagttcgccaagatctatggcgttcaggtcatacccgagatcgatgcg
cctgcacatgcgggcaatggctgggattggggacccaagcgcggaatgggcgagctggcc
atgtgcatcaaccagcagccatggagcttctactgtggcgaaccgccgtgcggtcagctg
aatcccaagaataactatacctacctcattctgcagcgcatctacgaggagttgttgcaa
cacacgggccccacagacttcttccacctgggcggtgacgaggtgaatcttgattgctgg
gcgcaatacttcaacgatacagatctccgcggattgtggtgcgatttcatgctccaggct
atggccagactaaaactggccaacaatggagtggcgcccaagcacgtggctgtctggtcg
agcgccctgaccaacacaaagtgtcttccaaacagtcaattcaccgttcaagtatggggc
ggcagcacctggcaggagaactacgatttgctagacaacggctacaacgtaatcttctcg
cacgtggacgcctggtatttggactgcggcttcggtagctggcgggccactggggatgct
gcctgtgctccgtaccgcacatggcagaacgtctacaaacacaggccgtgggagcgcatg
cgattggataagaagcgaaagaagcaggtactgggtggcgaagtgtgcatgtggaccgag
caggttgacgaaaatcagttggacaaccggctgtggccccgtacagccgctctggcggag
cgcttgtggactgatcctagcgatgatcacgatatggacatagtaccgccagatgttttc
cgtcgaatctcactgtttcgaaatcggctcgtcgaactgggcatccgagctgaagctctg
tttccaaaatactgtgcccagaatcccggcgaatgcatttga

DBGET integrated database retrieval system