KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8824Help
Entry
Dmel_CG8824       CDS       T00030                                 

Gene name
fdl
Definition
(RefSeq) fused lobes (EC:3.2.1.52 3.2.1.53)
  KO
K20730  
beta-hexosaminidase Fdl [EC:3.2.1.52]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dmel_CG8824 (fdl)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dmel_CG8824 (fdl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:49A9-49A10
AA seq 660 aa AA seqDB search
MSLAVSLRRALLVLLTGAIFILTVLYWNQGVTKAQAYNEALERPHSHHDASGFPIPVEKS
WTYKCENDRCMRVGHHGKSAKRVSFISCSMTCGDVNIWPHPTQKFLLSSQTHSFSVEDVQ
LHVDTAHREVRKQLQLAFDWFLKDLRLIQRLDYVGSSSEPTVSESSSKSRHHADLEPAAT
LFGATFGVKKAGDLTSVQVKISVLKSGDLNFSLDNDETYQLSTQTEGHRLQVEIIANSYF
GARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIV
GMGLAKMNRFHWHLTDAQSFPYISRYYPELAVHGAYSESETYSEQDVREVAEFAKIYGVQ
VIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQLNPKNNYTYLILQR
IYEELLQHTGPTDFFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMARLKLANNGVAP
KHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGS
WRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWP
RTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEALFPKYCAQNPGECI
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccttggctgtatcgctgcgccgagctctgttggtgctgctcaccggcgccatattc
atcctgacggtgctctactggaaccaaggagtcaccaaggcccaggcttacaatgaggcg
ctggaacgcccccacagccatcatgatgctagtggctttcccatacccgtcgagaagtcc
tggacgtacaagtgcgagaatgaccgatgcatgcgagtgggccaccatggtaaatctgcc
aagagggtctcgttcataagctgttcgatgacgtgcggtgacgttaacatttggccgcac
cccacccagaaattcctgctcagctctcagacgcacagcttctccgtggaggatgtgcaa
ctgcacgtagacacggcgcatcgcgaagtacgcaagcagctccaactggcttttgactgg
ttccttaaggatctcaggctaatccagcggctggactacgtgggtagttcatcagagccg
accgtaagcgaatcctcttcgaagtcacgccaccacgcggatttggaaccagctgccacg
ctctttggagctacctttggtgtaaagaaggctggggatctaactagcgtacaggttaag
attagcgtgctcaaatccggggatcttaactttagcctggacaatgacgagacctaccag
cttagcacacaaaccgaaggacaccgcctgcaggttgagatcatcgcaaattcttacttc
ggagcccggcatggtctgtccacgctacagcaactgatatggtttgacgacgaagatcac
cttttgcatacgtatgccaatagtaaggtgaaggatgcgcccaagttccggtatcgaggc
ctcatgctggacacctctcgccacttcttctctgtggagtccatcaagcgtacgattgtg
ggcatgggcttggccaagatgaaccgcttccactggcacctcacagatgcccagagtttt
ccctacatttcgcgctactatccagagttggccgtgcacggagcttactcggagagcgaa
acgtactcggagcaagatgttcgggaggtggccgagttcgccaagatctatggcgttcag
gtcatacccgagatcgatgcgcctgcacatgcgggcaatggctgggattggggacccaag
cgcggaatgggcgagctggccatgtgcatcaaccagcagccatggagcttctactgtggc
gaaccgccgtgcggtcagctgaatcccaagaataactatacctacctcattctgcagcgc
atctacgaggagttgttgcaacacacgggccccacagacttcttccacctgggcggtgac
gaggtgaatcttgattgctgggcgcaatacttcaacgatacagatctccgcggattgtgg
tgcgatttcatgctccaggctatggccagactaaaactggccaacaatggagtggcgccc
aagcacgtggctgtctggtcgagcgccctgaccaacacaaagtgtcttccaaacagtcaa
ttcaccgttcaagtatggggcggcagcacctggcaggagaactacgatttgctagacaac
ggctacaacgtaatcttctcgcacgtggacgcctggtatttggactgcggcttcggtagc
tggcgggccactggggatgctgcctgtgctccgtaccgcacatggcagaacgtctacaaa
cacaggccgtgggagcgcatgcgattggataagaagcgaaagaagcaggtactgggtggc
gaagtgtgcatgtggaccgagcaggttgacgaaaatcagttggacaaccggctgtggccc
cgtacagccgctctggcggagcgcttgtggactgatcctagcgatgatcacgatatggac
atagtaccgccagatgttttccgtcgaatctcactgtttcgaaatcggctcgtcgaactg
ggcatccgagctgaagctctgtttccaaaatactgtgcccagaatcccggcgaatgcatt
tga

DBGET integrated database retrieval system