KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8830Help
Entry
Dmel_CG8830       CDS       T00030                                 

Definition
CG8830 gene product from transcript CG8830-RB (EC:3.1.2.15)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG8830
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG8830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:49A4-49A6
AA seq 852 aa AA seqDB search
MAVKQNNSEAGDNASDNAGGAGNGIPPNAKPMSANGMANAEENVLPKGMDTGSPAGESLN
SNRSGKRDIKALLAYLQSIDMPEQGHNVMAICERVIVDLARLQIPRGASCPRLKEDVCQV
GAFLATRNEKFHQMFYLRVVYELITKSPFEPPPSCAVAIVFQLFDSTQILEAVHSLLEQN
VQDSSIKKTVNLLCDWITYCTFCSTLNLWVLALLKGLRDQGKMALLDEIAMDNIEKLFHV
MIFPALRQKAAPVVFHMLSTINQTPEVFHKILPRIPRVLQYVKNQSTTMDEIGLETKKCL
QQLVDLTSALMLRFYDQDELYVATKKALQTYEPSPNCVALAKAMHENAQPWGRRNARVGL
VNLGNTCYMNSVLQALAMTSDFSRQILLIECNSVLLMKVQQQIALMHHSLRYELTPSRVL
NATRPPSFTPGLQQDSSEFLGYLLDLLHEHEINSSSVTGHSVGPPKTGREVDDVPALLSE
DILSSGVIPYNSKDHELSSGSNSDNCNHKPTPTPPATPTKATNGLKQQGQQVDQAKPPST
IDKTFAGKLSTTYRCLNCGWESRNEDSFRELQLSFPDDKEDCGATNYSVQDLIEYYCSPE
KLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYDQKYHFRTKLMHKVFHDES
VTVKMSAKDSLQEMSTVHYDLYAGVVHAGYSMDSGHYFTFAADQAKNWYKFNDNVVTHSK
PEEMHNLTSPNTPYILFYKMCGHSNESNSVTASCSSSMVSGSNDQVVSVPLSPPLKLEEL
PRRLRDYVRKDNHVYNEELKMQRFKRGNSGHGNAFVSRHNFDGDGDEDDKAPPPPGGCGG
NGLGMNINRFVF
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggccgttaagcagaataacagcgaggcgggtgataatgcctcggataatgccggagga
gctggcaacggcattccgcccaacgccaaacccatgtccgcgaacggaatggcgaatgcc
gaagagaacgtattgccaaagggcatggacacgggttcgcccgctggcgagagcctgaac
tccaaccgatcgggcaagcgggatattaaggccctgctggcatacctccaaagcatcgat
atgccggagcaaggccacaatgtgatggccatctgcgagagggttatcgtggacttggcc
cgtctgcaaattccacgaggcgcatcctgtccacgcctaaaggaagacgtctgccaggtc
ggtgcctttctggctacgcgcaacgagaagttccaccaaatgttctacctgcgtgtcgtc
tacgagctgatcaccaagtcgccattcgagccaccaccctcgtgtgccgtggccattgtg
ttccagctgttcgactccacgcagatcctggaggctgtacactcgctgctggaacagaat
gtgcaggactcgagcattaagaagacggtgaacctgctctgtgattggatcacgtactgc
accttttgcagcactctcaatctttgggtgctggcgctgctcaaggggctaagggatcag
ggcaaaatggcgctgctcgacgagattgcaatggacaacatcgagaagctgttccacgtg
atgatctttccggcgctgaggcaaaaggccgcaccggttgtgtttcacatgctgtcaacg
attaatcagacccccgaggtttttcacaagatcttgccaaggatcccacgagtcctgcag
tatgtgaagaatcagtcgaccaccatggacgagattggcctggaaaccaagaaatgtctg
cagcaactggtcgacctaaccagcgccctaatgctacgtttctatgatcaggatgagctc
tatgtcgcaaccaagaaagccctgcagacctatgagccctctccgaattgcgtggctctg
gcaaaggcaatgcatgagaatgcccagccgtggggtcggcggaatgcgagggttggactc
gttaacctggggaatacctgctacatgaatagcgtacttcaggcgctagccatgaccagc
gattttagcaggcaaatcctgcttatcgagtgcaattcagtgctgctcatgaaagtgcag
cagcagattgccctgatgcatcactcgctgcgctacgaactaacgccttcgcgagtgctg
aacgccacccggccgcctagcttcacgcccggcctacaacaggacagctccgagttccta
ggatatctgctcgacctgctgcacgagcacgagatcaacagctcctcagtcactggtcac
agtgttggtcctccgaagaccggcagggaagtggacgacgtgcccgcactgctgagcgag
gatatattgtcgagcggcgttattccgtacaacagcaaggatcacgagctcagcagtgga
agcaacagtgacaattgtaatcacaagcccacaccgacaccacccgcgactcccaccaaa
gccaccaacggcttaaagcagcagggccagcaggttgatcaggcgaagccaccatctacc
attgacaagacgttcgctggcaagctttccaccacctatcgatgtttaaactgcggctgg
gagagccggaacgaggacagctttcgcgagctgcagctgtcttttcccgatgataaggaa
gactgtggagccaccaactactcggtgcaggatctgatcgagtactactgctcgcccgag
aagctggacggtgacaatcaatatttctgtccacaatgcaagaagctttgcgatgcggag
cgccacatcggggtcacccaggcaccgaagaaccttattctcacgctcaagcagttcaag
tacgatcagaagtaccacttccgcaccaagctcatgcataaggtgttccacgatgagagc
gtcacagtaaaaatgtcggcaaaggactcgctgcaggagatgtccactgtgcactatgat
ctgtatgcgggtgttgttcacgccgggtacagcatggattccggtcactactttacgttc
gcggcggatcaagccaagaattggtacaagttcaacgataacgtggttacccactccaag
ccggaggagatgcacaatctcacttcgcccaacacgccctacatcctgttctacaagatg
tgcggccactccaatgagtctaattcggttacggccagctgcagttcgagtatggtatcg
ggctcaaatgaccaggtggtctcggtgccactgtcgccgcctctgaagctggaggagttg
ccacgccgacttcgcgactacgtaagaaaggacaaccatgtttacaacgaagagttgaag
atgcaacgctttaagcgtggcaacagcggtcacggcaatgcgtttgtcagccggcacaac
tttgatggcgatggtgacgaggacgacaaggcgccgccgccgcccggaggatgtggaggc
aatggactgggcatgaacatcaaccgcttcgtcttctga

DBGET integrated database retrieval system