KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8983Help
Entry
Dmel_CG8983       CDS       T00030                                 

Gene name
ERp60
Definition
CG8983 gene product from transcript CG8983-RA (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG8983 (ERp60)
Enzymes [BR:dme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dmel_CG8983 (ERp60)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dmel_CG8983 (ERp60)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG8983 (ERp60)
  Exosomal proteins of bladder cancer cells
   Dmel_CG8983 (ERp60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:48C5-48C5
AA seq 489 aa AA seqDB search
MMWRLAGVLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE
YAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREAS
GIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKY
RFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVG
HRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQH
ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPE
SNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVK
MDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDR
SGKPKKTEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcgccttgctggagtgctcctactaggcttcatcgccatctcgtccggagcg
gagcaggatgtcctggaactgggggacgacgactttgccaccaccctaaaacaacacgag
acgacgctggtcatgttctacgccccctggtgcggccactgcaagcgattgaagcccgag
tacgccaaggcggcggagatcgtgaaagacgatgatccgccaatcaaactggccaaggtt
gactgtacggaagctggaaaggaaacgtgtagcaagtactccgtcagcggctacccaacg
ttgaagattttccgtcaggatgaggtgtcgcaggactacaatggaccacgcgaagccagc
ggcattgccaagtacatgcgcgcccaagtgggacccgcctccaagaccgtgcgcaccgtt
gccgagctgaaaaagttcctggacaccaaggacaccacgctgttcggctacttcagcgac
agcgactccaaactggccaagattttcctgaagttcgccgataagaaccgcgaaaagtac
cgcttcggacattcaagcgaaaaggaagtcctcgataagcagggcgaaaccgacaagatt
gtgcttattcgtgccccccatctgagcaacaagttcgagtcatcttccattaagttcgag
ggtagctccgagtccgatctgtctacctttgtcaaggagaacttccatggtcttgtggga
caccgcactcaggattcggtcaaggatttccagaatcctttgatcactgcctactacagc
gtggactaccagaagaaccccaagggaacgaactactggcgcaaccgtgtgctcaaggtg
gccaaggagtttgtgggtcaaatcaactttgcgatcgcctccaaggatgacttccagcac
gagttgaacgagtacggctacgatttcgttggcgacaagccagtggtattggctcgcgac
gaaaagaatctcaaatacgccctgaaggacgagttctcagtggagaatctgcaggacttt
gtcgagaagctgctggcgaatgagctggagccgtacattaagagtgagcctattcccgag
tcgaacgacgctcccgtcaaggtggccgtcgccaagaacttcgacgatctggttatcaac
aatggcaaagacacgctgattgagttctacgccccatggtgcggccactgcaagaagctg
agtcccatctacgaggagctggccgagaagctgcaagacgaagatgtggccatcgtcaag
atggacgccaccgccaacgatgtgccgccggagttcaacgtgcgcggcttccccaccctc
ttctggctgcccaaggacgccaagaacaagccagtcagctacaacggaggtcgcgaggta
gacgacttccttaagtacatcgccaaggaggcgaccacagaactgaagggcttcgaccgc
agcggcaagcccaagaagaccgagctctaa

DBGET integrated database retrieval system