KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9008Help
Entry
Dmel_CG9008       CDS       T00030                                 

Definition
CG9008 gene product from transcript CG9008-RA (EC:5.-.-.-)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG9008
Enzymes [BR:dme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Dmel_CG9008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:34D1-34D1
AA seq 308 aa AA seqDB search
MATTAAAMAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGAWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQF
RITYRLILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKT
RENALYQEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDR
SREMSDFGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQILQQFKCPYTIDPSSCRKKNY
LTNFLQYD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggccacgacagcggccgcaatggccgcaacgagtgtagttgttctggatcgcggaaac
aatacaacctgcaccatcaacttgcacggtgcgacggtcgtgtcctggcgggtaaacaat
caggagcagttgtttgtcagcaaactagcctcattcgatggcaagaaggcgatacgcggt
gggattccctttgtcttccctcagttcggtgcgtggtcctttgggccgcagcatggattt
gcgaggattaccaggtggcacctggagagaccgccagacaggcttcacaatggcgatgtg
gaggccatattttcgctgatggacaacgattttacgcgatccatatggaattatcagttt
cgcatcacttataggctgatcctgcgcgaaaaggagctgcacttccacatcggcgtctac
aatcccagcaaggagctgagcttcaccttcaacatgctgctgcacacctacctaaaggtg
cccgatgtgcgccgatgtcagatcaccggcctccagggctgtcacttcatcgacaagacg
cgggagaatgcgctctatcaggagggacgcgaggtggtcaccgtcaatgagtggaccgac
aggatctaccagcacacgccgcaggagcacgtcatcacaaacgtggtgtccggcaggaag
atgagactgcacaagtacaattttcccgatacggtcatctggaatccttggatcgatcga
tcgcgtgagatgagtgacttcggggacgacgagttccccaacatgttgtgcgtggaggcg
ggcaatgtgacatcgccggtgatcctgctgccgggcaccgctttcgaggccagccagatc
cttcagcaattcaagtgtccctataccatagacccatccagctgcaggaagaaaaactat
ctaaccaacttcttacaatacgactag

DBGET integrated database retrieval system