KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9012Help
Entry
Dmel_CG9012       CDS       T00030                                 

Gene name
Chc
Definition
Clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dme04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dme04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:13F5-13F7
AA seq 1678 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIDANKEPTTLFCFAVRTATGGKLHIIEVGAPPNGN
QPFAKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYVFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTNKALIDLFEGFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERYLKENQY
YDSRVVGRYCEKRDPHLACVAYERGLCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSESNPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLENYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGNRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESCKQDIAEELLGWFLE
RDAYDCFAACLYQCYDLLRPDVILELAWKHKIVDFAMPYLIQVLREYTTKVDKLELNEAQ
REKEDDSTEHKNIIQMEPQLMITAGPAMGIPPQYAQNYPPGAATVTAAGGRNMGYPYL
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccactgcccatccgctttcaggagcatttacagctcacaaatgtcgggatc
aacgccaattcattttcattcagcacgctcacgatggaatcggataagtttatttgcgtg
cgggagaaggtgaatgataccgcccaagtggtcatcattgacatgaacgatgccaccaat
cccacgcggcgtcccatctcagcggattcggctatcatgaatccagctagcaaggtcatt
gcgctcaaagcgcaaaagacgttgcagatcttcaacattgagatgaagtcgaagatgaag
gcgcataccatgaacgaggatgtggtgttctggaagtggatctccctcaatacgctagct
ctggtcacagaaacgagtgtgttccattggtccatggagggcgattcgatgccgcaaaag
atgtttgaccggcattcatcgctgaacggttgtcaaatcatcaactaccgctgcaatgcc
tcccagcagtggctactcttggtcggcatttcggcactgccaagtcgcgttgccggtgcc
atgcagttgtattcggtggagcgtaaggtgtcccaggcgatcgaggggcatgcggccagt
tttgccacgtttaaaatcgatgccaacaaggagccgaccacgctgttctgctttgcagtt
cgtacggccactgggggcaagcttcatattatcgaagttggtgctccgccgaacggcaat
cagccgtttgccaagaaggctgtcgatgtcttctttccgccggaagcacaaaatgatttc
cctgtggctatgcaagtctctgccaagtacgacaccatctacttgataaccaagtatgga
tacatacatctgtatgacatggagacggccacgtgcatatacatgaatcgtatatcggcc
gatacgatctttgttaccgcaccgcatgaggcaagtggtggcatcattggcgtcaatcgc
aagggacaggtcctctccgtgaccgtcgacgaggagcagatcattccctacatcaacacc
gttctgcagaatcccgatttggcccttcgcatggccgtgcgcaacaatttggctggtgcc
gaagatctctttgtgcgaaagttcaacaagctctttacagccggccagtatgctgaagcg
gctaaagttgctgccctggcacccaaggccattctgcgtacgccacagacgatccagcgt
ttccaacaggtgcagacaccagctggctccacgactccgccgctgctgcaatactttggc
attctcctcgaccagggcaagctgaacaagttcgagtctctcgagctgtgccgtcccgtc
ttgctgcagggcaagaagcagctgtgcgagaagtggctgaaggaggagaagttggaatgc
agcgaggagttgggtgatctggtcaaggcctccgatcttacacttgccctgtccatctat
ctgcgcgcaaatgtgcccaacaaggttatccaatgctttgctgagactgggcagttccag
aagattgtactctacgccaagaaggtcaactatacgcccgattacgtgttcctgctgcgc
tccgtgatgcgaagcaacccggagcaaggagctggtttcgcctctatgttggtggccgag
gaagagccactggcggacatcaatcagattgtggacatcttcatggagcactccatggtg
cagcagtgcactgcattcctgctggacgccctcaagcataaccgtcccgccgagggtgcc
ctccagacgcgcctgctggaaatgaatctgatgtctgctccgcaggtggccgacgccatc
ctgggcaatgctatgttcacccactacgatcgggcccacattgcccagctgtgcgagaag
gctggactgctccagcgcgccctcgagcactacacggatctgtatgacattaagcgggcc
gttgtgcacacgcacatgctgaatgccgaatggctggtcagtttctttggcacgctgtcg
gtggaggactcgctggaatgtctgaaggcaatgcttacggcgaatttgcgccagaacttg
cagatctgtgtgcagattgccaccaagtatcacgaacagctgaccaacaaggcactgatt
gatctgttcgaaggtttcaagagctacgacggactgttctacttcctgagcagcattgtc
aacttctcacaggatcccgaagtgcacttcaaatacattcaggcggcatgcaagactaat
cagattaaggaggtggagcgaatttgccgtgaatcaaactgctacaatcccgaacgggtg
aagaacttcttgaaggaggccaagctgacggatcagctaccattaattattgtttgtgat
cgttttgatttcgtgcacgacttggtgctttacctgtatcgtaacaatctgcagaagtac
attgagatctatgtgcagaaagtgaatccatcccgcttgccagtggtagtgggtggtctt
cttgatgttgattgcagtgaggatataattaaaaatctaattctcgtggtcaagggacaa
ttctcaaccgacgaactggtcgaggaggtcgagaagcgcaaccgtctcaagcttctcctt
ccctggctggagtcccgagttcacgagggctgcgtcgagccagccacccacaacgcgttg
gccaagatctacattgactcgaacaacaatcccgagagatatcttaaggagaatcagtac
tacgatagccgtgtggtcggtcgctactgcgagaagcgggatccccatttggcgtgtgtc
gcctacgagcgtggattgtgcgatcgcgagctgatcgccgtttgtaacgagaattctctg
ttcaagagcgaagcacgctacttggttggtcgccgcgacgccgaactctgggccgaggtc
ctttcggagagcaatccatacaagcgccagttgatcgatcaggtggtacagaccgctttg
tccgagacccaggatcccgatgacatctctgtaacggtcaaagcattcatgaccgccgat
ttgcccaatgagctgatcgaacttctcgagaagattattctggactcgtccgtctttagc
gaccatcgcaatctgcaaaacttgctcattctcacagccatcaaggctgatcgcacccga
gtcatggactacattaaccggctggagaactacgatgcaccggacatcgcgaacattgcg
atcagtaatcagttgtacgaagaagccttcgccatcttcaagaagttcgatgtgaacaca
tcggccattcaggtgctcatcgatcaagtgaacaacctggagcgggctaacgagttcgcc
gagcggtgcaatgagccggccgtttggtcgcagctggccaaggcccaactgcagcagggt
ctggtcaaggaggctatcgactcgtacatcaaggctgatgatccgagcgcttacgtcgat
gtcgtcgatgtggccagcaaggtggagtcttgggatgacctcgttcgctatctgcaaatg
gcacgcaagaaggcgcgcgaatcttacatcgagagcgaattgatctatgcctatgcgcgc
actggacgtctggccgatctggaggagttcatttcgggtcccaaccatgccgatatccag
aagattggcaaccgttgcttcagcgacggcatgtacgatgcagcgaagctactgtacaac
aatgtgagcaactttgcccgtctggccatcactttggtctacctgaaggagttccaaggg
gccgtggactcggcgcggaaagccaactcaacgcgcacatggaaggaggtgtgcttcgcc
tgcgtggacgccgaggagtttaggctagctcagatgtgcggcctgcacattgtggtgcat
gccgatgagctagaggatctgattaactactatcaaaaccgtggatacttcgatgaattg
attgcgctactcgagtcggctttggggctggaacgtgcgcacatgggaatgttcaccgaa
ttagctatactttattcaaaattcaaaccttccaaaatgcgcgaacacttggagctgttc
tggtctcgcgttaacattccaaaagttctgcgtgccgctgaatcggctcacttgtggtcg
gagctggtgttcctgtacgataagtacgaggagtacgataacgccgtcctggccatgatg
gctcatcccacggaggcgtggcgcgaggggcactttaaggacattatcaccaaggtagcc
aacattgagctgtactacaaggctatcgaattctatttggacttcaagccgctgctgttg
aacgacatgctgctcgtgctggcacccaggatggatcacactcgtgctgttagttacttc
tccaaaaccggctatttgccactcgtcaagccttatctgcgttcagtccaatctctcaat
aacaaggcaatcaacgaagccctgaacggactcttaatcgacgaggaggactaccagggt
ctgcgcaattcgatcgatggatttgataactttgacaacattgcgttggcacagaaactc
gaaaagcacgaacttaccgaattccgtaggattgccgcctacttgtacaagggaaataat
cgctggaaacagagcgttgagctctgcaaaaaggataaactctacaaggatgctatggag
tacgccgccgaatcttgcaagcaagatattgccgaagagttgttgggttggttcctagaa
cgtgacgcttacgattgttttgcagcttgtctttatcagtgttacgacttgctgcgccct
gatgttatcttggagttggcctggaaacacaaaatcgttgactttgccatgccctatttg
attcaggttctgcgcgaatacacaacaaaggtggacaaactggagttgaacgaggctcag
cgcgagaaggaggacgattccactgagcacaaaaacattattcagatggagccacaactg
atgatcaccgctggcccagcaatgggcattcctccacaatatgcacagaattatccacct
ggtgcagcaacggtaacggcggcaggaggacgcaacatgggctatccctacttgtag

DBGET integrated database retrieval system