KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9092Help
Entry
Dmel_CG9092       CDS       T00030                                 

Gene name
Gal
Definition
beta galactosidase (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dmel_CG9092 (Gal)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dmel_CG9092 (Gal)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dmel_CG9092 (Gal)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dmel_CG9092 (Gal)
   00511 Other glycan degradation
    Dmel_CG9092 (Gal)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmel_CG9092 (Gal)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dmel_CG9092 (Gal)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG9092 (Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:26B2-26B2
AA seq 670 aa AA seqDB search
MSGCRRNRKLTMAVSGCLIIAVMALTVGLCVGLSGDTDAPEPRFTIDHEANTFMLDGQPF
RYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFL
EIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMP
RLQHLFVGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMS
CGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQ
EVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAG
GVTTKYNLVKAVIGEFLPLPEITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPVES
IKPKTFEELDLYSGLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQIY
SLPLSKGWGSTLQLLVENQGRVNFYISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLE
QSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVAYV
NGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRANKTATGEDLPAVQFDAVAQL
DGESGDVPLK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttgtcgtcgcaatcgaaagctgacgatggccgtaagtggatgtctgataatt
gctgtgatggccctcaccgttgggctttgtgtgggactgagcggtgacaccgacgccccc
gagccaaggtttacgatcgaccatgaggccaacaccttcatgctggatggccagcccttc
cggtacgtctctggatcgtttcactatttccgcgctgtacccgagtcctggcgaagtcgg
ttgcgcaccatgcgagcatctggtcttaatgctctggatacctatgttgaatggtcgctc
cacaatccgcacgatggagaatacaactgggagggcattgcggatgttgtcaagtttctg
gagattgctcaggaggaagacttctacatcattctccgcccaggtccctacatttgtgct
gagcgagataatggtggtcttcctcactggttgtttaccaaatacccgtccatcaagatg
cggaccaatgaccccaactacatctcagaggtgggcaagtggtatgcggagctgatgcca
cgcctccagcacctgttcgtaggcaacggcggcaagatcataatggtgcaggtggagaac
gagtacggtgactatgcctgcgatcacgactacctcaactggctgcgagacgagacggag
aagtatgtgtccggcaaggcgctgctcttcacggtggacatacccaacgagaagatgagc
tgtggaaagatcgagaacgtgttcgccaccactgacttcggcatcgatcgcatcaatgag
attgacaaaatctgggcaatgctgcgtgccctgcagccgactggcccactggtcaactcg
gagttctatcccggctggctaacgcattggcaggagcagaaccaaaggcgtgatggccag
gaggtagccaatgcactaaggacaattctgagctacaacgctagtgttaacctctatatg
ttctttggcggcacaaactttgggttcactgctggtgccaactataatctggacggtggc
atcggatatgcggcagacataaccagctacgactacgatgcagtgatggacgaggccggt
ggcgtcaccactaagtacaaccttgtcaaggctgtgattggagaattccttccgctgccg
gaaatcaccttgaatcccgctaagcgtctggcctacggaagggtggagctgacacccaag
ctgacactgctctcgacggaaggacgtgctgcgctctccaagggtgatcccgtcgaatcg
atcaagccgaaaaccttcgaggaactagacttgtactcgggcctcgtcctgtacgagacc
gagctgcccagcatggatctagacccagccttgctgaaaatagatcaaattaacgatcga
gcacacgtattcgtagaccaggaactggtgggcacactctcccgcgaggcacagatctac
tcgctgccgcttagcaagggttggggcagcacactgcagctgctggtggagaaccaagga
cgcgtcaacttctacatctccaacgacacgaagggcatctttggtgaggtgagcctgcag
ctgcacaatggtggttacctcccgctggagaactggcggagcaccgctttcccgctggag
caatccgccgtcgagctctggcggcgcgaacacactgacgagaaggccttggacccgttg
ctggcaaggcaacgcattcttcgaaacggaccaatactctacactggcagcctgacagtg
acggaggtgggcgacacctatttgaacatggccggttggggcaagggcgtggcctatgtg
aacggttttaatttgggacgctactggcctgtggcaggtccacaggtcaccttatatgtg
cccaacgagatactgaaagtgggtgaaaactctctggtgatccttgagtaccaacgagcg
aataagacagcaactggcgaggatctacctgcagtgcagttcgacgcagttgctcagctg
gacggagagtctggtgatgttccacttaaatga

DBGET integrated database retrieval system