KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9111Help
Entry
Dmel_CG9111       CDS       T00030                                 

Gene name
LysC
Definition
Lysozyme C (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61F3-61F3
AA seq 140 aa AA seqDB search
MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLNKWACIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGW
SAWSTWHYCSGWLPSIDDCF
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttctggttgccctggcctgtgccgccccagctttcggtcgcacc
atggaccgttgctccctggcccgcgagatgtccaacctgggcgttccccgcgaccagctg
aacaagtgagcctgcattgccgagcacgagtcctcctaccgcaccggagtggttggtcct
gagaactacaacggctccaacgactacggaatcttccagatcaacgactactactggtgc
gcaatcgttttaatcggggtcaaaatcagtttagaagcagtcatcgatggacggcaacca
tccgctgcagtagtgccaggtggaccaggcggaccatccctgctggctgaggaccttctg
ggcacaacggacggagtgggtgatgtcgtc

DBGET integrated database retrieval system