KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9116Help
Entry
Dmel_CG9116       CDS       T00030                                 

Gene name
LysP
Definition
Lysozyme P (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dmel_CG9116 (LysP)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG9116 (LysP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61F4-61F4
AA seq 141 aa AA seqDB search
MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVG
PANSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQG
WTAWSTWKYCSGSLPSINSCF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttcttgtgatttgtgctctgactctcacagcagtcgctacccaggcccga
acgatggataggtgttccctagccagggagatgtccaaactgggcgttccccgggaccag
ctggccaagtggacctgcatcgcccagcacgagagttccttccgcaccggcgtcgttgga
ccggccaactccaacggatccaatgactacggcatctttcagatcaacaacaagtactgg
tgcaagccggccgacggacgcttctcctacaacgagtgcggcttgagctgcaatgccctc
ctaaccgacgacatcaccaattccgtgaagtgcgcccggaagatccagcgccagcaggga
tggactgcttggtccacatggaagtactgcagcggatccctgccctcgatcaacagttgc
ttctag

DBGET integrated database retrieval system