KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9116Help
Entry
Dmel_CG9116       CDS       T00030                                 

Gene name
LysP
Definition
Lysozyme P (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61F4-61F4
AA seq 141 aa AA seqDB search
MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVG
PANSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQG
WTAWSTWKYCSGSLPSINSCF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttcttgtgatttgtgctctgactctcacagcagtcgctacccaggcccga
acgatggataggtgttccctagccagggagatgtccaaactgggcgttccccgggaccag
ctggccaagtggacctgcatcgcccagcacgagagttccttccgcaccggcgtcgttgga
ccggccaactccaacggatccaatgactacggcatctttcagatcaacaacaagtactgg
tgcaagccggccgacggacgcttctcctacaacgagtgcggcttgagctgcaatgccctc
ctaaccgacgacatcaccaattccgtgaagtgcgcccggaagatccagcgccagcaggga
tggactgcttggtccacatggaagtactgcagcggatccctgccctcgatcaacagttgc
ttctag

DBGET integrated database retrieval system