KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9118Help
Entry
Dmel_CG9118       CDS       T00030                                 

Gene name
LysD
Definition
(RefSeq) lysozyme D
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dmel_CG9118 (LysD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT Transglycosylas
Motif
Other DBs
NCBI-GeneID: 38127
NCBI-ProteinID: NP_476823
FlyBase: FBgn0004427
UniProt: P83972
Position
3L
AA seq 140 aa AA seqDB search
MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGW
SAWSTWHYCSGWLPSIDDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttctggttgccctggcctgtgccgccccagctttcggtcgcacc
atggaccgttgctccctggcccgcgagatgtccaacctgggcgttcctcgtgaccaattg
gctcgttgggcctgtattgccgagcacgagtcctcctaccgcaccggagtggttggtccc
gagaactacaacggctccaacgactacggaatcttccagatcaacgactactactggtgc
gctcctcccagcggtcgcttctcctacaacgaatgcggattgagctgcaacgctctcctg
accgacgacatcacccactccgtccgttgtgcccagaaggtcctcagccagcagggatgg
tccgcctggtccacctggcactactgcagcggatggttgccgtccatcgatgactgcttc
taa

DBGET integrated database retrieval system