KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9118Help
Entry
Dmel_CG9118       CDS       T00030                                 

Gene name
LysD
Definition
Lysozyme D (EC:3.2.1.14 3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dmel_CG9118 (LysD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61F3-61F3
AA seq 140 aa AA seqDB search
MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGW
SAWSTWHYCSGWLPSIDDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttctggttgccctggcctgtgccgccccagctttcggtcgcacc
atggaccgttgctccctggcccgcgagatgtccaacctgggcgttcctcgtgaccaattg
gctcgttgggcctgtattgccgagcacgagtcctcctaccgcaccggagtggttggtccc
gagaactacaacggctccaacgactacggaatcttccagatcaacgactactactggtgc
gctcctcccagcggtcgcttctcctacaacgaatgcggattgagctgcaacgctctcctg
accgacgacatcacccactccgtccgttgtgcccagaaggtcctcagccagcagggatgg
tccgcctggtccacctggcactactgcagcggatggttgccgtccatcgatgactgcttc
taa

DBGET integrated database retrieval system