KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9156Help
Entry
Dmel_CG9156       CDS       T00030                                 

Gene name
Pp1-13C
Definition
Protein phosphatase 1 at 13C
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dmel_CG9156 (Pp1-13C)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmel_CG9156 (Pp1-13C)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dmel_CG9156 (Pp1-13C)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dmel_CG9156 (Pp1-13C)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dmel_CG9156 (Pp1-13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:13B9-13B9
AA seq 302 aa AA seqDB search
MAEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggttctcaatttggagagcataatttcccgtctgttggaggtgcgtggcgca
cggcctggcaagaatgtccagctgtcggagggtgagatacggggcctgtgcctcaagtcg
cgcgaaatactgctggcacagcccatactcttagagctggaggcgccgctcaagatctgc
ggcgatatccatggccagtactatgatctgttgcgtctgttcgagtacggcggctatccg
ccggaggctaactatcttttcttgggcgattacgtggacaggggcaagcagtcgctggag
accatctgcctgctgttggcgtacaagatcaagtattcggagaacttctttttgttgcgc
ggcaatcacgagtgcgccagcattaatagaatctatggattctacgacgagtgcaagcgc
agatataccatcaagttgtggaagacattcacggactgcttcaactgtctgccagttgtg
gccattgtggatgagaagatcttttgctgccacggcggactgagtccggatcttacctcg
atggagcagatccgtcgtattatgcgtcccaccgatgttcccgatcagggactactctgt
gacctgctgtggtccgatccggacaaggacaccattgggtggggcgagaacgaccgtggc
gttagtttcacctttggcgccgaagttgtggtcaagttcctccaaaagcacgatctggat
ctgatctgtcgtgcccatcaagtcgtcgaggatggttacgagttctttgccaagcgccaa
ttggtcactttgttttccgcccccaactattgcggtgaattcgacaatgctggtgccatg
atgtccgtggacaatacactcatgtgctccttccaaatcctgaagcctgtcgagaagcgc
aagaagtag

DBGET integrated database retrieval system