KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9156Help
Entry
Dmel_CG9156       CDS       T00030                                 

Gene name
Pp1-13C
Definition
Protein phosphatase 1 at 13C
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dme03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:13B9-13B9
AA seq 302 aa AA seqDB search
MAEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggttctcaatttggagagcataatttcccgtctgttggaggtgcgtggcgca
cggcctggcaagaatgtccagctgtcggagggtgagatacggggcctgtgcctcaagtcg
cgcgaaatactgctggcacagcccatactcttagagctggaggcgccgctcaagatctgc
ggcgatatccatggccagtactatgatctgttgcgtctgttcgagtacggcggctatccg
ccggaggctaactatcttttcttgggcgattacgtggacaggggcaagcagtcgctggag
accatctgcctgctgttggcgtacaagatcaagtattcggagaacttctttttgttgcgc
ggcaatcacgagtgcgccagcattaatagaatctatggattctacgacgagtgcaagcgc
agatataccatcaagttgtggaagacattcacggactgcttcaactgtctgccagttgtg
gccattgtggatgagaagatcttttgctgccacggcggactgagtccggatcttacctcg
atggagcagatccgtcgtattatgcgtcccaccgatgttcccgatcagggactactctgt
gacctgctgtggtccgatccggacaaggacaccattgggtggggcgagaacgaccgtggc
gttagtttcacctttggcgccgaagttgtggtcaagttcctccaaaagcacgatctggat
ctgatctgtcgtgcccatcaagtcgtcgaggatggttacgagttctttgccaagcgccaa
ttggtcactttgttttccgcccccaactattgcggtgaattcgacaatgctggtgccatg
atgtccgtggacaatacactcatgtgctccttccaaatcctgaagcctgtcgagaagcgc
aagaagtag

DBGET integrated database retrieval system