KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9273Help
Entry
Dmel_CG9273       CDS       T00030                                 

Gene name
RPA2
Definition
Replication protein A2
Orthology
K10739  
replication factor A2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dmel_CG9273 (RPA2)
   03420 Nucleotide excision repair
    Dmel_CG9273 (RPA2)
   03430 Mismatch repair
    Dmel_CG9273 (RPA2)
   03440 Homologous recombination
    Dmel_CG9273 (RPA2)
   03460 Fanconi anemia pathway
    Dmel_CG9273 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:38F6-38F6
AA seq 246 aa AA seqDB search
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcatttggagatttcaatgccacacaaactgcgccaactggagccgccagc
aatcaaaagggagaaggaatagtgcccctggtggtgaagcagattgtggacgccccagag
ggaaacatcgagttgttcggcatgcagtacgccatggcatgtgttgtggccatagtgcgg
aacgtggagacttcctcgacgaagatcacctacaccctggaggatcatagcggcaggatc
gatgcgcactactggcttgaggagggcgacgctctcaaggcacccgaagtaatggtcaac
aactacgtgaaggtctacggcaccacccggtcgcaaggcggttccaaaaccctaatgatc
ttcaagctactgcccgttttggatcccaacgaggtgtgcacccacctgctggaagtactc
aatgcccgctacagggccgaggactaccagagcaagggtggagctggagctggtgcaggg
gcttcttccggctcaggctccatagctgatttcaccgcctcccagagctcggccattgtc
agtgggctggagcccaagcagcaggccgtattccaggccatcaagagcaatgtttccgag
gagggcatctcccgcaaggaactgaaagccaaattctcccacatcagcgactctgagttg
accaacattctggactttatgatttccgagggacacatttattccagcattgacgcagat
cactttatttgcacaatgtaa

DBGET integrated database retrieval system