KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9273Help
Entry
Dmel_CG9273       CDS       T00030                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2, isoform B
  KO
K10739  
replication factor A2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dmel_CG9273 (RPA2)
   03420 Nucleotide excision repair
    Dmel_CG9273 (RPA2)
   03430 Mismatch repair
    Dmel_CG9273 (RPA2)
   03440 Homologous recombination
    Dmel_CG9273 (RPA2)
   03460 Fanconi anemia pathway
    Dmel_CG9273 (RPA2)
DNA replication proteins [BR:dme03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dmel_CG9273 (RPA2)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dmel_CG9273 (RPA2)
   MMR (mismatch exicision repair)
     Dmel_CG9273 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dmel_CG9273 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 246 aa AA seqDB search
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcatttggagatttcaatgccacacaaactgcgccaactggagccgccagc
aatcaaaagggagaaggaatagtgcccctggtggtgaagcagattgtggacgccccagag
ggaaacatcgagttgttcggcatgcagtacgccatggcatgtgttgtggccatagtgcgg
aacgtggagacttcctcgacgaagatcacctacaccctggaggatcatagcggcaggatc
gatgcgcactactggcttgaggagggcgacgctctcaaggcacccgaagtaatggtcaac
aactacgtgaaggtctacggcaccacccggtcgcaaggcggttccaaaaccctaatgatc
ttcaagctactgcccgttttggatcccaacgaggtgtgcacccacctgctggaagtactc
aatgcccgctacagggccgaggactaccagagcaagggtggagctggagctggtgcaggg
gcttcttccggctcaggctccatagctgatttcaccgcctcccagagctcggccattgtc
agtgggctggagcccaagcagcaggccgtattccaggccatcaagagcaatgtttccgag
gagggcatctcccgcaaggaactgaaagccaaattctcccacatcagcgactctgagttg
accaacattctggactttatgatttccgagggacacatttattccagcattgacgcagat
cactttatttgcacaatgtaa

DBGET integrated database retrieval system