KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9302Help
Entry
Dmel_CG9302       CDS       T00030                                 

Definition
(RefSeq) CG9302 gene product from transcript CG9302-RA
  KO
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dmel_CG9302
Chaperones and folding catalysts [BR:dme03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dmel_CG9302
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dmel_CG9302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:34B8-34B9
AA seq 510 aa AA seqDB search
MWITGQFVFLLLVALVAAKSKTSAVQDDIAEYKDFKKLLRTKNNVLALYVTSAKSAAAEL
KIFREAAEAIRGTGTMLLLDCGQQDRKKLCKKLKVSPDPYAIKHYKDGDFHKDYDRQLSV
SSMITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGEN
NKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFE
VNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDDDNFSSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLK
TKLDYNGGRTSKDFIAYMNNPPTSADRTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggataaccggtcagtttgtttttcttctgctggtggcacttgttgccgcaaaatcg
aaaacctcggcggtgcaggatgacatcgcggagtataaggacttcaagaagctgctgcgc
accaagaacaatgtcctcgcgctctacgtgaccagtgcgaagtccgctgctgctgagcta
aagatattccgtgaggcggcggaggcgatacggggaaccgggacaatgttgctgctagat
tgcggacagcaggatcgcaagaaactgtgcaagaagttgaaggtatcgccggacccctac
gccattaaacactacaaggatggcgacttccacaaggactacgaccggcagctgagcgtc
agctccatgatcactttcatgcgtgatccctccggcgatttgccctgggaggaggatcca
gccggcaaggatgtcctgcacttcagcgatgccgcatccttcacaaagcatttacgcaag
gatatccggcccatgcttgtcatgttctatgttccgtggtgcggattctgcaagaaaatg
aagccagagtacggaaaagcgtctacggagttgaaaactaagggcggttatattctggcg
gctatgaatgtagagcgacaggagaacgctcctatacgcaaaatgttcaacataactggt
tttcccaccctgatttactttgaaaacggcaagctgcgctttacatacgaaggagagaac
aacaaggaggctttggtgtcttttatgctcaatccaaatgccaagccaacgccaaagccc
aaggaacccgaatggtcggcggataccaactcggagattgtccatctcacctcgcagggt
tttgagcccgctctgaaggacgagaagtccgccctggtcatgttctatgcaccctggtgc
ggacactgtaagcgcatgaaaccggaatacgaaaaggccgctctggagatgaagcagaaa
aagattcccggccttttggctgcgttggatgcaacgaaggagccgtcaatcgcagagaaa
tacaaagtcaagggctatccaactgttaagtttttctcgaatggcgtctttaagtttgaa
gtaaatgtacgcgaagcatcgaaaattgttgaatttatgagagatcccaaggagccccca
ccgcctccgccacccgaaaagagttgggaggaggaggaggacagcaaggaagtcctattt
ctggatgacgacaacttcagttcgacgctgaagaggaaaaagcatgcgctggtcatgttc
tatgcaccctggtgtggacactgtaagcacacaaaaccggagtttacagcggctgccacg
gccttacaggatgatcctcggatagcgtttgtcgccatcgactgcacaaagcttgccgcg
ctctgcgcaaagtataacgtacgcggatatcccaccattctgtacttctcttacctcaaa
accaagctggattacaatggcggacgcaccagcaaggactttatcgcctatatgaacaac
ccgcctacctcagcggaccgcacagagctgtga

DBGET integrated database retrieval system