KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9375Help
Entry
Dmel_CG9375       CDS       T00030                                 

Gene name
Ras85D
Definition
Ras oncogene at 85D
Orthology
K07827  
GTPase KRas
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:dme04013]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dme04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dme04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:85D19-85D19; 3R:3-50 cM
AA seq 189 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL
ASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKP
NRRFKCKML
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatacaaactggtcgtcgttggagccggaggcgtgggcaagtccgcgctcacc
atccagctaatccagaaccatttcgtggacgagtacgaccccacaatcgaggactcttac
cgaaagcaagtggttatcgatggagagacctgcctgctggacatcctggacaccgccggc
caagaggagtactcggccatgcgggatcagtatatgcggactggcgagggattcctgctg
gtctttgccgtcaacagtgcgaagtccttcgaggatatcggcacctaccgtgagcagatc
aagcgcgtaaaggatgccgaagaggtgcccatggtgctggtgggcaacaaatgtgatctg
gcctcgtggaacgttaacaacgagcaggcaagagaggtggccaaacagtacggcattcca
tacattgagacatccgccaagacgcgcatgggcgtggacgatgcattttacacactggtg
cgcgaaatccgcaaggacaaggacaacaaggggcggaggggccgcaaaatgaacaagccg
aatcgtagatttaaatgtaaaatgctctaa

DBGET integrated database retrieval system