KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9375Help
Entry
Dmel_CG9375       CDS       T00030                                 

Gene name
Ras85D
Definition
(RefSeq) Ras oncogene at 85D
  KO
K07827  
GTPase KRas
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Apoptosis - fly
Dorso-ventral axis formation
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG9375 (Ras85D)
   04068 FoxO signaling pathway
    Dmel_CG9375 (Ras85D)
   04150 mTOR signaling pathway
    Dmel_CG9375 (Ras85D)
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG9375 (Ras85D)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG9375 (Ras85D)
  Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG9375 (Ras85D)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG9375 (Ras85D)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    Dmel_CG9375 (Ras85D)
GTP-binding proteins [BR:dme04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    Dmel_CG9375 (Ras85D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:85D19-85D19; 3R:3-50 cM
AA seq 189 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL
ASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKP
NRRFKCKML
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatacaaactggtcgtcgttggagccggaggcgtgggcaagtccgcgctcacc
atccagctaatccagaaccatttcgtggacgagtacgaccccacaatcgaggactcttac
cgaaagcaagtggttatcgatggagagacctgcctgctggacatcctggacaccgccggc
caagaggagtactcggccatgcgggatcagtatatgcggactggcgagggattcctgctg
gtctttgccgtcaacagtgcgaagtccttcgaggatatcggcacctaccgtgagcagatc
aagcgcgtaaaggatgccgaagaggtgcccatggtgctggtgggcaacaaatgtgatctg
gcctcgtggaacgttaacaacgagcaggcaagagaggtggccaaacagtacggcattcca
tacattgagacatccgccaagacgcgcatgggcgtggacgatgcattttacacactggtg
cgcgaaatccgcaaggacaaggacaacaaggggcggaggggccgcaaaatgaacaagccg
aatcgtagatttaaatgtaaaatgctctaa

DBGET integrated database retrieval system