KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9390Help
Entry
Dmel_CG9390       CDS       T00030                                 

Gene name
AcCoAS
Definition
Acetyl Coenzyme A synthase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dme01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dme00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dme00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dme00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:78C3-78C4
AA seq 670 aa AA seqDB search
MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFL
KYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
PDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
KYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDL
KKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaaaaatcaatatacgatcccaacccggccatcagccaaaatgcctacata
tccagcttcgaggagtaccagaagttctaccaggagtcactggacaatccggccgagttc
tggtcccgcgtggccaagcagttccactgggaaacgccagccgatcaggataagttcctc
aagtacaacttcaacatctcgaagggacccatttcgatcaaatggatggagggtgcctcc
accaatctgtgctacaatctcctagatcgcaacgttaggaacggcctgggcgaccagata
gcctactactgggagggcaaccaccccgacgattattcccggggtctcacctatcgcaag
ttgctggaggaggtgtgccgcttcgccaacgtgctgaaggatcatggcattcgaaagggc
gatcgtgtatccatttacatgcccatgattctggagctgcctatcgcgatgctggcctgc
gctcgcattggagccgtgcactcgatcgtattcgccggattctcaccggactcactggcg
gagcggatgttcgattgcaaggccaagctgctgattacggcggatggagcctggcgtgga
gagaaacccctgtacctgaaggctctgtgcgacacggccttggagaaagtcgaggagatg
gggcactccgtggagaagtgcatcgtggtgtcgcatttgaagcgagtgactccgtgccag
ccggatcatgtcgaggaggaaatcccatggaccgatgaccgcgattactggtggcacgag
gagatggaggacaaggagccggcctgctatccggagtggatggacgccgaggatccattg
ttcatgctctacaccagtggctccactggcaagcccaagggagtgctccacacgactgcc
ggatatctgctgtatgcggccacgacctttaagatcgtatttgactataagccaggggat
atctactggtgcaccggcgatgttggctggatcacgggacacacctacgtggtgtacgga
ccattggccaatggagccacttcagtgattttcgaaggcacaccattcttccctggaaac
gatcggtactggagtgtcattgacaaatataaggtaactcagttctacacagctccaacg
gcgattcgtgccctcatgaagttcggcgagggtcccgttctaaagcacaacctgagcgga
ctcaaagttttgggcagcgtgggtgagcccatcaacccggaggcctggctctggtattac
aaatacattggaaaggagcagtgctccattgtggacaccttttggcaaacggaaaccggt
ggtcatgtcattacacctctgcctggagcgactcccatgaagccgggatctgcttcattc
cccttctttggagtgaagcccactttgctggatgagtgcggcattgaaattaagggggag
ggagagggctacttggtcttctcgcaaccttggccgggaatgatgcgcactttgtacaac
aaccatgaacgcttcgaggacacttatttctccaagttcccaggctactactgcactggc
gatggagcccgacgcgatgctgacggctatttgtggatcactggtcgtgtggacgacatg
ttaaacgtgtccgggcacctgatgtccactgccgaggtagagtcggttctcacagagcat
cctcgcgtggctgagtccgccgtggtttcccgtccgcatcccgtcaagggcgagtgtctc
tactgcttcataacgccgaacgagaacgaggtattcgaccagaagctaatttcggacctg
aagaagatggtgcgagaacgtatcggaccttttgccatgccggatgtcattcaaaacgct
cccggactgcccaaaactcgttccggcaagattatgcgtcgtgtgctgcgcaagatcgcg
gttaacgatcgcaacgtgggcgacacatctaccttggccgatgagcaaattgtggagcaa
ctgttcgccaaccggccagtggaggccaagtag

DBGET integrated database retrieval system