KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9390Help
Entry
Dmel_CG9390       CDS       T00030                                 

Gene name
AcCoAS
Definition
Acetyl Coenzyme A synthase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG9390 (AcCoAS)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG9390 (AcCoAS)
   00620 Pyruvate metabolism
    Dmel_CG9390 (AcCoAS)
   00640 Propanoate metabolism
    Dmel_CG9390 (AcCoAS)
Enzymes [BR:dme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dmel_CG9390 (AcCoAS)
Lipid biosynthesis proteins [BR:dme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dmel_CG9390 (AcCoAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:78C3-78C4
AA seq 670 aa AA seqDB search
MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFL
KYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
PDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
KYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDL
KKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaaaaatcaatatacgatcccaacccggccatcagccaaaatgcctacata
tccagcttcgaggagtaccagaagttctaccaggagtcactggacaatccggccgagttc
tggtcccgcgtggccaagcagttccactgggaaacgccagccgatcaggataagttcctc
aagtacaacttcaacatctcgaagggacccatttcgatcaaatggatggagggtgcctcc
accaatctgtgctacaatctcctagatcgcaacgttaggaacggcctgggcgaccagata
gcctactactgggagggcaaccaccccgacgattattcccggggtctcacctatcgcaag
ttgctggaggaggtgtgccgcttcgccaacgtgctgaaggatcatggcattcgaaagggc
gatcgtgtatccatttacatgcccatgattctggagctgcctatcgcgatgctggcctgc
gctcgcattggagccgtgcactcgatcgtattcgccggattctcaccggactcactggcg
gagcggatgttcgattgcaaggccaagctgctgattacggcggatggagcctggcgtgga
gagaaacccctgtacctgaaggctctgtgcgacacggccttggagaaagtcgaggagatg
gggcactccgtggagaagtgcatcgtggtgtcgcatttgaagcgagtgactccgtgccag
ccggatcatgtcgaggaggaaatcccatggaccgatgaccgcgattactggtggcacgag
gagatggaggacaaggagccggcctgctatccggagtggatggacgccgaggatccattg
ttcatgctctacaccagtggctccactggcaagcccaagggagtgctccacacgactgcc
ggatatctgctgtatgcggccacgacctttaagatcgtatttgactataagccaggggat
atctactggtgcaccggcgatgttggctggatcacgggacacacctacgtggtgtacgga
ccattggccaatggagccacttcagtgattttcgaaggcacaccattcttccctggaaac
gatcggtactggagtgtcattgacaaatataaggtaactcagttctacacagctccaacg
gcgattcgtgccctcatgaagttcggcgagggtcccgttctaaagcacaacctgagcgga
ctcaaagttttgggcagcgtgggtgagcccatcaacccggaggcctggctctggtattac
aaatacattggaaaggagcagtgctccattgtggacaccttttggcaaacggaaaccggt
ggtcatgtcattacacctctgcctggagcgactcccatgaagccgggatctgcttcattc
cccttctttggagtgaagcccactttgctggatgagtgcggcattgaaattaagggggag
ggagagggctacttggtcttctcgcaaccttggccgggaatgatgcgcactttgtacaac
aaccatgaacgcttcgaggacacttatttctccaagttcccaggctactactgcactggc
gatggagcccgacgcgatgctgacggctatttgtggatcactggtcgtgtggacgacatg
ttaaacgtgtccgggcacctgatgtccactgccgaggtagagtcggttctcacagagcat
cctcgcgtggctgagtccgccgtggtttcccgtccgcatcccgtcaagggcgagtgtctc
tactgcttcataacgccgaacgagaacgaggtattcgaccagaagctaatttcggacctg
aagaagatggtgcgagaacgtatcggaccttttgccatgccggatgtcattcaaaacgct
cccggactgcccaaaactcgttccggcaagattatgcgtcgtgtgctgcgcaagatcgcg
gttaacgatcgcaacgtgggcgacacatctaccttggccgatgagcaaattgtggagcaa
ctgttcgccaaccggccagtggaggccaagtag

DBGET integrated database retrieval system