KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9441Help
Entry
Dmel_CG9441       CDS       T00030                                 

Gene name
Pu
Definition
Punch (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmel_CG9441 (Pu)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dmel_CG9441 (Pu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:57C7-57C8; 2R:2-97 cM
AA seq 308 aa AA seqDB search
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSLADRQQNQAEE
ATAIAGTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDSDGHEKCTFHHDLELDHKPPT
REALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFD
EDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQE
RLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREE
FLNLVNSK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagctttacccgccaactgtccgagatgagtgccagcgagctgaacgatgccatcgac
gacaccaacttcccgcaggcccacatcctttcgcgcggacgcaacaacagcgtctgctca
acaagtagcacctcgggcacctcctcgctggcggacaggcagcagaaccaggcggaggag
gccactgccattgcgggcacacccgtcgaggaggtggcgccagctcctgctctcgtcccg
ttggccggcaaccagagaccccgcctcatcctgaagaccaacggcagcagtccggatagt
gatggccacgagaagtgcacgttccaccacgacctggagctggaccacaagccgccgacg
cgagaggccctccttccggacatggcacgctcgtatcgtctactcttgggcggcctgggc
gagaatcccgatcgccagggactgatcaagacgccggagcgggcagccaaggccatgctg
tacttcaccaagggctacgaccagagtctcgaggatgttctcaatggcgccgttttcgac
gaggatcatgacgaaatggtggtggtcaaggatattgaaatgttctccatgtgcgagcat
catctggtgcccttctacggcaaagtttccatcggttatttgccgtgcaacaagattctc
ggactcagtaaattggcacgcattgtcgaaatattttcgcgtcgcctgcaagtccaggag
cgcttaactaagcagatcgcagtggccgtgactcaggccgtgcaacccgctggagtagca
gtggtcgtagagggagtccacatgtgcatggtgatgcgtggcgtgcagaagatcaacagc
aaaactgttacctcaactatgctgggcgtgttccgagacgatcccaagacccgtgaggaa
ttcctgaacttagtcaatagcaaatag

DBGET integrated database retrieval system