KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9485Help
Entry
Dmel_CG9485       CDS       T00030                                 

Definition
CG9485 gene product from transcript CG9485-RF (EC:2.4.1.25 3.2.1.33)
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dmel_CG9485
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dmel_CG9485
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Dmel_CG9485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:57D11-57D11
AA seq 1563 aa AA seqDB search
MSTMGKETESHSIPISEGQDAEHILYRLKRGSKLSVHPDASLLGRKIVLYTNYPAEGQKF
VRTEYRVLGWQLSNGKQITSVMHPEAHVVDTDIRSQVELNMSGTYHFYFRYLERFETILF
RIDFALALMCVNIFRPDTGCSGADGALYVQVEPTLHVGPPGAQKTIPLDSVRCQTVLAKL
LGPLDTWEPKLRVAKEAGYNVIHFTPIQELGGSRSCYSLRDQLKVNSHFAPQKGGKISFE
DVEKVIKKCRQEWGVASICDIVLNHTANESDWLLQHPDATYSCATCPYLRPAFLLDATFA
QCGADIAEGSLEHVGVPAVIEQECHLEALKYQLHTSYMSKVNIHELYQCDVMKYVNEFMS
QVRTREPPKNVANECRFQEIQLIQDPQYRRLASTINFELALEIFNAFHGDCFDEESRFRK
CAETLRRHLDALNDRVRCEVQGYINYAIDNVLAGVRYERVQGDGPRVKEISEKHSVFMVY
FTHTGTQGKSLTEIEADMYTKAGEFFMAHNGWVMGYSDPLRDFAEEQPGRANVYLKRELI
SWGDSVKLRFGRRPEDSPYLWQHMTEYVQTTARIFDGVRLDNCHSTPLHVAEYLLDAARK
INPELYVVAELFTNSDYTDNVFVNRLGITSLIREALSAWDSHEQGRLVYRYGGVPVGGFQ
ANSSRHEATSVAHALFLDLTHDNPSPVEKRSVYDLLPSAALVSMACCATGSNRGYDELVP
HHIHVVDEERTYQEWGKGVDSKSGIMGAKRALNLLHGQLAEEGFSQVYVDQMDPNVVAVT
RHSPITHQSVILVAHTAFGYPSPNAGPTGIRPLRFEGVLDEIILEASLTMQSDKPFDRPA
PFKKDPNVINGFTQFQLNLQEHIPLAKSTVFQTQAYSDGNNTELNFANLRPGTVVAIRVS
MHPGPRTSFDKLQKISAALRIGSGEEYSQLQAIVSKLDLVALSGALFSCDDEERDLGKGG
TAYDIPNFGKIVYCGLQGFISLLTEISPKNDLGHPLCNNLRDGNWMMDYISDRLTSYEDL
KPLSAWFKATFEPLKNIPRYLIPCYFDAIVSGVYNVLINQVNELMPDFIKNGHSFPQSLA
LSTLQFLSVCKSANLPGFSPALSPPKPPKQCVTLSAGLPHFSTGYMRCWGRDTFIALRGS
MFLTGRYNEARFIIIGFGQTLRHGLIPNLLDSGSKPRFNCRDAIWWWMYCIKQYVEDAPK
GAEILKDKVSRIFPYDDADAHAPGAFDQLLFDVMQEALQVHFQGLQYRERNAGYEIDAHM
VDQGFNNQIGIHPETGFVFGGNNFNCGTWMDKMGSSQKAGNKGRPSTPRDGSAVELVGLQ
YAVLRFMQSLAEKEVIPYTGVERKGPSGEVTKWSYKEWADRIKNNFDKYFFVSESETCSV
ANKKLIYKDSYGATQSWTDYQLRCNFPITLTVAPDLCNPQNAWRALERAKKYLLGPLGMK
TMDPEDWNYRANYDNSNDSTDCTVAHGANYHQGPEWVWPIGFYLRARLIFAKKCGHLDET
IAETWAILRAHLRELQTSHWRGLPELTNDNGSYCGDSCRTQAWSVAAILEVLYDLHSLGA
DVA
NT seq 4692 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatgggcaaggagacggagtcgcatagcatacccatcagcgagggccaggat
gcggagcatatcctgtaccgtctgaagcggggttccaagctgagtgttcatccggatgcc
tcgttgctgggcaggaagatcgtattgtacaccaactatcccgccgagggacagaagttt
gtgcgtacggagtatcgcgtgctgggatggcaactcagcaatggcaagcagattacctct
gtaatgcatccggaggcccatgtggtagatactgacattcgtagtcaggtggagctcaac
atgtccggcacctaccacttttacttccggtatctggaaaggttcgaaactatacttttc
cgcattgattttgctttagcattaatgtgtgtcaacattttcagacccgacactggctgc
tccggagcagatggagctctatatgtgcaagtggagcccacgctgcatgttgggccgcct
ggcgcccagaagaccattcccttggactcggtgcgctgccaaacggtgctggccaagctc
ctgggaccactggacacttgggagcctaagctgcgcgtggcaaaggaggccggatacaat
gtgatccacttcactcccatccaggagttgggtggctcccgatcctgctattcgctgcgt
gatcaactcaaggtcaactcccattttgcaccccaaaagggaggtaagatcagttttgag
gatgtggagaaggtcatcaagaagtgccgccaggagtggggggtggcctccatctgcgac
atcgtgctcaatcacaccgccaacgagtccgattggctactacagcatccggatgccacc
tactcatgcgccacctgtccctacctccgccccgccttcctgctggacgccacattcgcc
cagtgcggagcggacatagccgagggcagcctggagcatgtaggcgtacctgcggtcatc
gagcaggagtgccatttggaagcgttaaagtaccagttgcacacctcctacatgtccaag
gtcaatatacacgagctgtatcagtgcgatgtgatgaagtacgtgaacgagttcatgtcc
caggtgcgaactcgcgagccaccgaagaatgtggccaacgagtgtcgcttccaggaaatc
caactgatacaggacccgcaatatcgacgcttggccagcaccattaatttcgagctggcg
ctggagatctttaatgctttccatggcgactgcttcgatgaggagtcacggttccgcaag
tgcgccgaaaccctccgccggcatctcgatgccctcaacgatcgtgtgcgctgcgaggtt
caaggctacataaactatgcgatagacaatgttttggccggagttcgctacgaaagagtc
cagggcgatgggcccagagtgaaggagatctccgagaagcactcggtctttatggtctac
tttacgcataccggcacccagggaaaatcgctcactgagatcgaggcggatatgtatacc
aaggctggagagttcttcatggcccacaacggttgggtcatgggatacagcgatcctctg
agggattttgctgaggagcaacctggacgcgccaatgtctacctcaagcgggagctcatc
tcgtggggcgatagtgtgaagttgcgcttcggcagacggccggaggacagtccctaccta
tggcagcacatgaccgagtacgttcagaccacagcgcgcatcttcgacggtgtgcgattg
gacaactgccactccacgccattgcacgtagctgagtaccttctcgatgcagctcgtaag
atcaacccagagctgtatgtggtggctgaactgttcaccaattccgattacaccgacaat
gtgtttgtgaaccgattgggtatcacctccttgatccgtgaagctctttccgcttgggac
tcccacgagcaaggccgcttagtgtatcggtatggaggagtgcctgtaggtggtttccaa
gcaaactcatcgcgccacgaggccaccagtgtcgctcatgccctcttcctggacctcacc
cacgataatccgtctccggtggagaagcgttccgtgtacgatcttctaccatcggcggca
ctggtttccatggcatgctgtgccacaggaagtaaccgtggttacgacgaactggtcccc
catcatatccatgtcgtagatgaggaacgcacctaccaagaatggggcaaaggtgttgac
tcgaagtccggaattatgggtgccaaaagagcactgaatttgctgcatggacagctcgca
gaggagggatttagccaagtttacgtagaccagatggatcccaacgtagttgcagttact
cgtcattcgccaatcacgcatcagtcagttattctcgtggcccacactgcctttggctat
ccctctcctaatgccggacccaccggaatccgcccgctgcgtttcgagggtgtgctggac
gagatcatcctggaggccagcttgaccatgcagagtgacaagccattcgatcgtcctgct
ccattcaaaaaggatccgaatgtaatcaacggctttactcagttccagttgaatctgcag
gagcacatcccgctggctaagtcgacagtgtttcagacccaagcctattcggatggcaac
aacacggagctaaactttgccaatctacgacccggcactgtggtggccatcagagtgtct
atgcatcctggtcctcgcaccagtttcgataagctccagaaaatctcggctgccctgcgt
attggatctggcgaggagtattcccagctgcaggctatcgtctccaagttggatctggtg
gcacttagtggtgcccttttcagctgcgatgatgaggagagggatcttggcaaaggtggc
accgcctacgacattcccaactttggaaagatcgtttactgcggattgcaaggattcatt
tccctgttgacggagatttcgcctaaaaatgacttgggacatccgctttgtaacaatctg
cgcgacggaaactggatgatggattacatttctgatcgcctaactagttatgaagacctg
aaaccactctccgcctggttcaaagctacctttgagccactgaagaatattccacgctac
ctcataccctgctactttgatgccattgtcagcggggtttacaatgtgctcatcaaccag
gtcaacgaactaatgccagacttcattaagaatggccacagtttcccacaatccctggcc
ctgtccacgttgcagttcctctccgtttgcaagtcggccaatctgccgggattcagtcct
gctctaagtccacccaagcctccaaagcaatgtgtgactctatctgctggtctgccgcat
ttctcaacgggctatatgcggtgctggggccgtgataccttcatcgctctgcgtggctcc
atgttcctcactggccgttacaacgaggctcgcttcatcatcattggatttggtcagacc
cttcgacacggactcattccgaatcttttggacagcggcagcaagccgagattcaactgc
cgcgatgctatctggtggtggatgtactgcatcaagcagtatgtggaggatgcccccaag
ggtgccgagatcctgaaggacaaggtgtcccgcatatttccgtacgacgatgccgatgcc
catgctccaggtgccttcgaccaacttctcttcgacgtgatgcaggaggcactgcaggtg
cattttcagggcttgcagtatagggagcgcaatgcaggctatgagatcgatgcgcacatg
gtggaccagggctttaacaatcagatcggaattcacccggagactggctttgtattcgga
ggcaataacttcaactgcggcacttggatggacaaaatgggatcctcacagaaggccgga
aacaagggacgtccaagtacgccgcgcgacggatcagccgtggagctcgttggcctccag
tatgccgtactccggtttatgcaaagcctagccgaaaaggaggttatcccgtacaccggc
gtggaacgaaagggtccatcgggcgaagtgaccaagtggagctacaaggagtgggcggat
cgcatcaagaacaactttgacaagtatttctttgtatccgaatcggaaacctgctcggtg
gccaacaagaagcttatctacaaggacagctatggagccacccagagttggacggactac
cagctgcgatgcaacttccccatcaccttgaccgtggctcccgacctgtgcaatcctcag
aatgcctggcgtgcactggagcgcgccaaaaagtatcttctgggaccgctgggcatgaag
acgatggatcccgaggactggaactatagggccaactatgacaactcaaatgactccacc
gattgcactgtagcccatggcgcaaactaccaccaggggccggagtgggtatggcccatc
ggtttttacctgcgggcgcgcctgatcttcgccaaaaagtgtggccatttggacgagacc
attgccgagacctgggccatactacgggcccatctccgagagctacagacatcccattgg
cgcggattgcccgagttgaccaacgataatggctcctactgcggtgactcctgtcgcacg
caggcctggagtgttgctgccattttggaagtcctgtacgatctgcactccttgggagca
gacgtggcctaa

DBGET integrated database retrieval system