KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9553Help
Entry
Dmel_CG9553       CDS       T00030                                 

Gene name
chic
Definition
chickadee
Orthology
K05759  
profilin
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:26A5-26B2
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccagtggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggctttgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggtacatttacctttccggcacagaccgcgtggtgcgcgcc
aagctcggccggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tacgaggatcccgttcagccccagcaggccgcttccgtggtagagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system