KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9553Help
Entry
Dmel_CG9553       CDS       T00030                                 

Gene name
chic
Definition
(RefSeq) chickadee
  KO
K05759  
profilin
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG9553 (chic)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dmel_CG9553 (chic)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG9553 (chic)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:26A5-26B2
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccagtggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggctttgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggtacatttacctttccggcacagaccgcgtggtgcgcgcc
aagctcggccggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tacgaggatcccgttcagccccagcaggccgcttccgtggtagagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system