KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9659Help
Entry
Dmel_CG9659       CDS       T00030                                 

Gene name
egh
Definition
egghead (EC:2.4.1.-)
Orthology
K02359  
egghead protein (zeste-white 4 protein)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG9659 (egh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:3A6-3A6; X:1-1.2 cM
AA seq 457 aa AA seqDB search
MNSTTKHLLHCTLLITVIVTFEVFSGGIKIDENSFTLVDPWTEYGQLATVLLYLLRFLTL
LTLPQVLFNFCGLVFYNAFPEKVVLKGSPLLAPFICIRVVTRGDFPDLVKTNVLRNMNTC
LDTGLENFLIEVVTDKAVNLSQHRRIREIVVPKEYKTRTGALFKSRALQYCLEDNVNVLN
DSDWIVHLDEETLLTENSVRGIINFVLDGKHPFGQGLITYANENVVNWLTTLADSFRVSD
DMGKLRLQFKLFHKPLFSWKGSYVVTQVSAERSVSFDNGIDGSVAEDCFFAMRAFSQGYT
FNFIEGEMYEKSPFTLLDFLQQRKRWLQGILLVVHSKMIPFKHKLLLGISVYSWVTMPLS
TSNIIFAALYPIPCPNLVDFVCAFIAAINIYMYVFGVIKSFSLYRFGLFRFLACVLGAVC
TIPVNVVIENVAVIWGLVGKKHKFYVVQKDVRVLETV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaccacaaagcatctgctgcactgcacactgctcatcactgtgatagttacc
ttcgaagtattctccggcggtattaagattgacgagaactcgttcacgctcgtggatcct
tggactgaatacggccaattggccacggttctgctgtacttattgcgctttctcacgctg
ctcacgctgccccaggtgctgttcaatttctgcggcctggtattctacaatgccttcccc
gagaaggtcgtcctcaagggcagccccctgctggcgcccttcatctgcatccgtgtggtc
acgcgcggcgacttcccggatttggttaagacgaatgtgctgcgcaacatgaacacctgc
ctagacacgggactggagaactttctcatcgaagtggtcacggacaaggcggtgaatctg
tcacagcatcgacgcatccgagagatcgttgtgcccaaggagtacaagacgagaaccggg
gcgttgttcaagtcgcgtgccctgcagtattgcctggaggataatgtgaacgtgctgaac
gacagcgactggatcgtccatctggatgaggagacgctgctcacggagaattcggtgcgt
ggtatcattaactttgtgctggatggcaagcacccgttcggccagggcctgatcacctat
gccaacgagaacgtggtcaattggctgaccacattggcggacagctttcgggtctccgat
gatatgggcaagctgcgtctgcagttcaagctctttcacaagccgctcttcagctggaag
ggcagttatgtggtcacccaggtgagtgctgagcgttcagtgtcctttgacaacggaatc
gacggttcggtggccgaggattgcttcttcgcgatgcgggcctttagccagggctacacg
ttcaacttcatcgagggcgaaatgtacgagaagtcgccgttcacgctgctggacttcctg
cagcagaggaaacgatggctccagggcattctgctggtggtccactccaagatgatcccg
tttaagcacaagctcctgctgggcatcagtgtctattcgtgggtcaccatgccgctgtcc
acgtcgaacatcatctttgcggcactgtatcccattccctgcccaaatctggttgacttt
gtgtgcgccttcatcgcggccattaatatctacatgtacgtctttggcgtaatcaagtcc
ttttcactgtaccgcttcggtttgttccgattcctggcctgcgtgctgggtgcggtgtgc
acgatacccgtgaatgtggttatcgagaatgtggctgtcatttggggcctggtgggcaag
aagcacaagttctatgtggttcagaaggatgtgcgcgtactggagactgtctag

DBGET integrated database retrieval system