KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9738Help
Entry
Dmel_CG9738       CDS       T00030                                 

Gene name
Mkk4
Definition
MAP kinase kinase 4 (EC:2.7.11.- 2.7.11.13)
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG9738 (Mkk4)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dmel_CG9738 (Mkk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:85A5-85A5
AA seq 424 aa AA seqDB search
MAERPKNLFATGSSRSRNPPDQLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTR
CFGAQQPQQTPPVASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGGANTHTFTSD
DLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIY
IVQFYGALFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLK
EELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERA
KGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEF
VDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADILESMEKDGITQFTANQ
QAES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacgaccgaaaaatttgtttgcaaccggatccagtcgctcccgcaatcccccg
gatcagctaagcctgaataatcttagcatacgccatccgccctcgtccacgtcgtccact
tcttcgggatccacctcctcgggctcaagttcctcatcacagcacaaccatgtgacccgc
tgttttggtgcccagcagccacagcaaaccccgccggtggccagcagtcaagtgccaccg
gtgccggcagcatcgagcagcagcgctgccgatcgtcaccgggagcgaattcgccagcag
gcctgtggcaagctacagtttggtgagggcggcgctaatacacacacatttacttcagac
gatctcgaggatgagggcgaaattggacgcggtgcatttggggcagtcaacaagatgacc
tttaagaaattggacaaggtgatggccgtcaagcgcattcgatccaccgtagacgagaag
gaacagaagcagctgctcatggatctcgaggtggtcatgaagtccaacgagtgcatttac
attgttcagttctatggggcgcttttcaaggagggtgactgctggatttgtatggagctg
atggacacctctttggacaagttttacaagtacatctacgaaaagcagcagcgccacatt
ccagagtctatactggctaagataacagtggccacggtcaatgcgctgaactatttgaag
gaggagctaaagattatccatcgggatgtgaaaccgagcaacattctgttgcaccgtcgc
ggagacataaagctgtgcgattttggtatttcgggtcagctggtcgactctattgccaag
accaaggatgcgggctgcaggccctacatggcgccggagcgcattgatccagaacgtgcc
aagggctacgatgtacgaagcgatgtttggtcattgggcatcacattaatggaggtggcg
actggtaatttcccctatcgtaaatgggactctgttttcgagcagttgtgccaggttgtg
caaggcgaaccgccgcgacttttgacatcctataacggcatggagttttccaaagagttt
gtggactttgtcaatacttgcctaattaaaaaggagagcgatcgacccaagtatagccgt
ctgctggagatgcccttcatacgtcgtggcgagacgagccacactgatgttgccgtgtat
gtggctgatatactggagtcgatggagaaagacggcattacgcagtttacggccaatcag
caggcggagagttaa

DBGET integrated database retrieval system