KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9743Help
Entry
Dmel_CG9743       CDS       T00030                                 

Definition
CG9743 gene product from transcript CG9743-RA (EC:1.14.19.- 1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dme01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dme01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:99E2-99E2
AA seq 420 aa AA seqDB search
MCLSSPIPGQKQATSVGHCNGSCSLDRNGNRSAAIVPNGGELKHRGHATDATSHTLVKDD
DNLGYKEENAVYKEQQLLQQQDQTLKEAEQVEEEEEYHPQIRWPDLGAQAFLHIGALYGL
YQLFYANFYTFLWVVVTVWVSGIGITAGAHRLWSHKSYTASLPLRILLAFAFSIAGQRDA
YTWALDHRIHHKFSETDADPHNAKRGFFFAHVGWLFLTPHPKVVAKRKVIDMSDLEADAV
CMFQRKYYIPLFALCSIILPVAVPWYFWNEDLWMSFWINFNMRFTWTLNVAFFVNSVAHM
YGNKPYDKNLMSTEAPIVSLLAMGEGWHNYHHVFPWDYKTGEFGNYSLNITTGFIDFCAW
LGLAKGRKSVSPDMVLRRAKKCGDGTRFLDDDHAHKDPVWGFGDKDIPREDIVELAKMQN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctttcatccccgattcccggccagaaacaggcgacgtctgttggccactgcaac
ggatcgtgcagcctggacaggaatggcaaccgcagcgcagccattgtcccgaatggagga
gagctgaagcacagaggccatgccacagacgctacatcacacaccctggtcaaagatgac
gacaatttgggctacaaggaggagaacgcggtctacaaggagcagcagctgctgcagcaa
caggaccagacgctgaaggaggcggagcaggtggaggaggaagaggagtaccacccgcag
atcagatggccggatctgggagcacaggcattcctgcacatcggtgccctctacggactg
taccagctcttctacgcgaacttctacacattcctctgggtggtggtcaccgtttgggtc
tccggcatcggcatcacggcgggagcccatcgcctctggtcccacaagtcctacactgca
tcgctgcccctgaggattctgctggcctttgccttttcgatcgccggccagagagatgcc
tacacgtgggcccttgatcacaggatacatcacaagttctcggagacagacgccgatccg
cacaatgcgaagcgtggtttcttcttcgcccacgtgggctggctgttcctaacgccccat
cccaaggtggtggccaagaggaaggtcatcgacatgtccgatctggaggcggatgccgtc
tgcatgttccagcggaagtactacataccgctcttcgcgctctgctccatcatcctgccg
gtggccgtgccctggtacttctggaacgaggatctctggatgtccttctggatcaacttc
aacatgcgcttcacctggaccctcaacgtggccttcttcgtgaacagcgtggcgcacatg
tacggcaacaagccgtacgacaagaacctcatgtccactgaggctcccattgtctccctg
ctggccatgggagagggatggcacaattaccaccacgttttcccctgggactacaagacg
ggcgagtttggcaactacagcctcaacatcaccaccggcttcatcgacttttgcgcctgg
ctaggcctggccaaaggacgtaaatcggtatcccctgacatggtcttgaggagagccaag
aaatgcggcgatggaactcgcttcctggacgacgaccatgcccacaaggatccggtgtgg
ggcttcggggacaaggacattccccgagaggatatcgtggagctggccaagatgcagaac
taa

DBGET integrated database retrieval system