KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9765Help
Entry
Dmel_CG9765       CDS       T00030                                 

Gene name
tacc
Definition
transforming acidic coiled-coil protein
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG9765 (tacc)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dmel_CG9765 (tacc)
   mRNA cycle factors
    P-body specific factors
     Dmel_CG9765 (tacc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:82D2-82D2
AA seq 245 aa AA seqDB search
MSVDVIDNDCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELREE
ALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHLT
SLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNHAMQQLE
IANKKLDTYSREHADETKKLKALLKKEEISRVSMTEQLQQKSRENADLLKICEELIYGKG
QGGSS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtggacgtcattgataacgattgcaataaaaccttcgataattccaacactaat
acggaggataagacgcacaactacaacgatatggatgagctggagaagaaaatcaaaaat
gaagtaacgaggtccgaagacattgaaaagaagctcaaggagggagagctgcgcgaggag
gctctgatcaagcgtattacagaaaaggacaaaacaaatgcaaaactaaacggtgtcatt
gaggcatatgagaaggcaattgcagagctcattagtgagaaggagcagcaagcacagctt
cacgaacggcagttgcaggaagtccaggcagaccgggacgcaaattaccatcacttaaca
tcgttggagacgacattttccgatctgcatgtgaaatacgagaaaagcaaagagatgacc
tcgcagcttaaaagtaacgaggaatcgcttctggcagagcgaaagcagatgatggacaat
ctgcggttgcaggaacagcgctacgacaagatgaagaaccatgccatgcagcagctggaa
attgccaacaaaaagctggacacctactcgagggagcatgccgacgagacgaaaaaactt
aaagctttacttaagaaggaggagatctcgcgggtctcgatgacggagcagctgcaacag
aagtcccgcgaaaacgctgatctgctcaagatctgcgaagagctcatctatggcaaggga
caaggtggtagtagttaa

DBGET integrated database retrieval system