KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9819Help
Entry
Dmel_CG9819       CDS       T00030                                 

Gene name
CanA-14F
Definition
Calcineurin A at 14F
Orthology
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG9819 (CanA-14F)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmel_CG9819 (CanA-14F)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     Dmel_CG9819 (CanA-14F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:14E3-14F1
AA seq 584 aa AA seqDB search
MSSPAAQSNSSSSQSQSAAQQQQQQNQKANVNNTHDNKNAAATTGTAAGSGSGGAAGSAG
TQQQGQGGTGTSSGPSSPTKRSTISTKERVIDSVAFPPSRKLTCADVFDARTGKPQHDVL
KQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGG
SPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQEC
KIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGP
MCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDA
GYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNF
MDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIG
KMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAK
GLDAVNERMPPRRDATPSPAEEGQKSLSAAAAAAANANANSING
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgccggcggcgcagagcaacagcagcagcagccagtcgcagtccgcagcccag
cagcagcagcagcagaatcaaaaggccaatgtcaacaacacacacgacaacaagaatgcc
gcggcgacgacggggacagcggcgggatcgggatcaggcggagcggcaggctcggcgggc
acacagcagcagggtcagggcggcactggaacctcgagcggtccatccagcccaaccaag
cgcagcacaatatcgacaaaggagcgtgtgatcgacagcgtggcatttccgccgagccgt
aaactcacctgcgcggatgtgttcgacgcgcggaccggaaagccgcagcacgatgtcctc
aagcagcacttcatcctggagggcaggatcgaggagagcgccgccctgcgcattatccaa
gagggcgccacgctattgcgcacggaaaagacgatgatcgacatcgaggcgccggtgacg
gtgtgcggcgatatccatggccagttctacgatctgatgaagctattcgagattgggggc
tcgccggcgaccaccaagtatctgttcctgggcgactacgtcgatcggggctacttcagc
atcgagtgcgtactgtatttgtggtcgctaaagatcacctatccgcagacgctgttcctg
ctgcgcggcaaccacgagtgccggcacttaaccgagtacttcaccttcaagcaggagtgc
aagatcaagtactcggagcgcgtgtacgacgcctgcatggacgcattcgactgcctgccg
ctggcggcgctcatgaaccagcagttcctctgcgtgcacggcggtctgtcgccggagata
cacgagctggaggacatccgacggctcgaccgcttcaaggagcctcccgcctttggcccc
atgtgcgacctgctgtggtccgatccgctggaggacttcggcaacgagaagaactcggac
ttctacacgcacaactccgtgcgcggctgctcgtacttctacagctacgccgcctgctgc
gacttcctgcagaacaacaacctgctgtcgatcatccgggcgcacgaggcgcaggacgcc
ggctaccgcatgtaccgcaaaagccagaccaccggcttcccctcgctgatcaccatcttc
tcggcgcccaactatctcgacgtgtacaacaacaaggcggcggtgctgaagtacgagaac
aacgtgatgaacatccggcaattcaactgctcgccgcacccgtactggctgcccaacttc
atggacgtgttcacctggtcgctacccttcgtgggcgagaaggtcaccgagatgttggtg
aacgtgctgaacatctgctccgacgacgagctcatgaccgaggagagcgaggagccactc
tccgacgacgaggcggcgctgcgcaaggaggtgatacgcaacaagatccgtgccattggc
aagatggcgcgcgtcttctccgtgctgcgcgaggagtccgagtcggtgctgcagctgaag
ggactgacgcccacgggcgccctgcccctcggcgccctctccggcggcaagcagtcgctc
aagaacgccatgcagggcttctcgcccaatcacaagattacctcgttcgcggaggccaag
ggcctggatgccgtcaacgaacggatgccgccgcggcgggatgcaacgccctcgccggcg
gaggagggccagaaatcactgtcagccgcggcagcagcagcggccaatgcaaatgcgaat
tcaatcaatggataa

DBGET integrated database retrieval system