KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9862Help
Entry
Dmel_CG9862       CDS       T00030                                 

Gene name
Rae1
Definition
(RefSeq) Rae1
  KO
K14298  mRNA export factor
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03013  RNA transport
Module
dme_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG9862 (Rae1)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dmel_CG9862 (Rae1)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dmel_CG9862 (Rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Nup160 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 37467
NCBI-ProteinID: NP_611597
FlyBase: FBgn0034646
UniProt: Q9W2E7
Position
2R
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKC
HRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacgaaccgaatgaacgacttcgaggtcgcctcgccgccg
gacgactccgtctcggcgctggagttcagccccagcacggtgcagaagaacttcctggtg
gccggaagctgggacagcacggtccgctgctgggaggtggaacaaaacggggccactgtg
cccaagtcgatgaagaccatgggcggaccggtgctggacgtttgctggtcggacgacggc
agcaaagtgttcgtcgcctcctgcgacaagcaggtgaagctctgggacctcgcctccgat
caagtgatgcaagtggcggcccacgacggtcccgttaagacgtgccacatggtcaaggga
cccacgtacacctgcctcatgaccggctcctgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcggtgctactgcgccgatgtg
gagtatccgatggccgtggtgggcacggccaacagaggactcatcatatactcgctgcag
aatagcccaaccgagtacaagcggcaggagagtccgctgaagtaccagcaccgtgccatt
tccattttccgggacaagaaaaaagagcccacaggctgtgcgctgggcagcattgagggc
cgtgtggccattcagtatgtgaatccggggaatccaaaagataacttcaccttcaagtgc
caccgtactacgggcacctcaggctaccaggatatttatgcagtaaatgacatcgcattc
caccctgtgcacggcaccctggtgaccgttggctcagatggcaccttcagtttctgggac
aaggatgcccggaccaagctcaagtccagcgagaccatggatcagtccattaccaaatgc
ggatttaacgccaacggccagatatttgcgtacgccgtcggctacgactggtcgaagggc
cacgagtacttcaacccggccaagaagccccaaatctttctgcgctcgtgctacgacgag
ctcaagccgcgcattaactga

DBGET integrated database retrieval system