KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9862Help
Entry
Dmel_CG9862       CDS       T00030                                 

Gene name
Rae1
Definition
CG9862 gene product from transcript CG9862-RA
Orthology
K14298  
mRNA export factor
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG9862 (Rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:57F6-57F6
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKC
HRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacgaaccgaatgaacgacttcgaggtcgcctcgccgccg
gacgactccgtctcggcgctggagttcagccccagcacggtgcagaagaacttcctggtg
gccggaagctgggacagcacggtccgctgctgggaggtggaacaaaacggggccactgtg
cccaagtcgatgaagaccatgggcggaccggtgctggacgtttgctggtcggacgacggc
agcaaagtgttcgtcgcctcctgcgacaagcaggtgaagctctgggacctcgcctccgat
caagtgatgcaagtggcggcccacgacggtcccgttaagacgtgccacatggtcaaggga
cccacgtacacctgcctcatgaccggctcctgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcggtgctactgcgccgatgtg
gagtatccgatggccgtggtgggcacggccaacagaggactcatcatatactcgctgcag
aatagcccaaccgagtacaagcggcaggagagtccgctgaagtaccagcaccgtgccatt
tccattttccgggacaagaaaaaagagcccacaggctgtgcgctgggcagcattgagggc
cgtgtggccattcagtatgtgaatccggggaatccaaaagataacttcaccttcaagtgc
caccgtactacgggcacctcaggctaccaggatatttatgcagtaaatgacatcgcattc
caccctgtgcacggcaccctggtgaccgttggctcagatggcaccttcagtttctgggac
aaggatgcccggaccaagctcaagtccagcgagaccatggatcagtccattaccaaatgc
ggatttaacgccaacggccagatatttgcgtacgccgtcggctacgactggtcgaagggc
cacgagtacttcaacccggccaagaagccccaaatctttctgcgctcgtgctacgacgag
ctcaagccgcgcattaactga

DBGET integrated database retrieval system