KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9862Help
Entry
Dmel_CG9862       CDS       T00030                                 

Gene name
Rae1
Definition
(RefSeq) Rae1
  KO
K14298  
mRNA export factor
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG9862 (Rae1)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dmel_CG9862 (Rae1)
Chromosome [BR:dme03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dmel_CG9862 (Rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKC
HRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacgaaccgaatgaacgacttcgaggtcgcctcgccgccg
gacgactccgtctcggcgctggagttcagccccagcacggtgcagaagaacttcctggtg
gccggaagctgggacagcacggtccgctgctgggaggtggaacaaaacggggccactgtg
cccaagtcgatgaagaccatgggcggaccggtgctggacgtttgctggtcggacgacggc
agcaaagtgttcgtcgcctcctgcgacaagcaggtgaagctctgggacctcgcctccgat
caagtgatgcaagtggcggcccacgacggtcccgttaagacgtgccacatggtcaaggga
cccacgtacacctgcctcatgaccggctcctgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcggtgctactgcgccgatgtg
gagtatccgatggccgtggtgggcacggccaacagaggactcatcatatactcgctgcag
aatagcccaaccgagtacaagcggcaggagagtccgctgaagtaccagcaccgtgccatt
tccattttccgggacaagaaaaaagagcccacaggctgtgcgctgggcagcattgagggc
cgtgtggccattcagtatgtgaatccggggaatccaaaagataacttcaccttcaagtgc
caccgtactacgggcacctcaggctaccaggatatttatgcagtaaatgacatcgcattc
caccctgtgcacggcaccctggtgaccgttggctcagatggcaccttcagtttctgggac
aaggatgcccggaccaagctcaagtccagcgagaccatggatcagtccattaccaaatgc
ggatttaacgccaacggccagatatttgcgtacgccgtcggctacgactggtcgaagggc
cacgagtacttcaacccggccaagaagccccaaatctttctgcgctcgtgctacgacgag
ctcaagccgcgcattaactga

DBGET integrated database retrieval system