KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9306Help
Entry
Dmel_CG9306       CDS       T00030                                 

Gene name
ND-B22
Definition
(RefSeq) NADH dehydrogenase (ubiquinone) B22 subunit, isoform B
  KO
K03965  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00190  Oxidative phosphorylation
dme01100  Metabolic pathways
Module
dme_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Dmel_CG9306 (ND-B22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_LYR_2 Complex1_LYR
Motif
Other DBs
NCBI-GeneID: 34747
NCBI-ProteinID: NP_001285889
FlyBase: FBgn0032511
UniProt: Q9VJZ4
Position
2L
AA seq 144 aa AA seqDB search
MAQVPLAIVSHKRQVCSLYKRALRNLESWYDRRNVYRYRAVQLRARFDENRSKDLGEGIR
LLACGQRELFETRHFQPRNFANSAGGCAFEREVIPPDWVLDYWHPLEKAQYPEYFAKREQ
RKKEFVTWWEKQYGKPDPKDLGHH
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagttcccttggcaatcgtctcgcacaagcgccaggtgtgcagcctgtacaag
cgagcactgcgcaacttagagtcgtggtacgaccgacgcaatgtctaccgctaccgcgct
gtgcagctgcgtgctcgcttcgacgaaaaccgctccaaagatctgggcgagggcatccgc
ctcctagcctgtggacaaagggagcttttcgagacaaggcatttccagccccgaaacttt
gccaacagtgccggtggctgtgctttcgaacgagaggtgattccgcccgactgggtcctg
gactactggcatcccctggagaaggcccagtaccccgagtactttgccaagcgggagcag
cgcaagaaggagtttgtgacctggtgggagaagcagtacggcaagcccgaccccaaggac
ctgggacaccactaa

DBGET integrated database retrieval system