KEGG   Dehalococcoides mccartyi GY50: GY50_0539Help
Entry
GY50_0539         CDS       T02938                                 

Definition
radical SAM superfamily protein / histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dmg  Dehalococcoides mccartyi GY50
Brite
Enzymes [BR:dmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GY50_0539
Transfer RNA biogenesis [BR:dmg03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    GY50_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492302..493681
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPESPAVLRAKSCEYQAYKQ
VALRLRIIQDMGHPTDKVELIVMGGTFLSADTAYQYGFIKDCYDALNGIVAGSLEEAKTI
NETAQHRCVGLCIETRPDICGETEIQRMIDFGTTRVELGVQMLDDDIYKLVERGHTVADV
AEATRLLREYGLKVHYHWMPGLPGSAPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTV
LEEWWKEGRYTPYPSDIMTGLIADIKALVPPYVRISRVLRDIPAVFISAGLKDSLRDGVR
QILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPASEGNEIFLSFEDSSDTLYGL
LRLRIPRLSLPVPDKKYGGKIGLVRELHVYGIELSLGEQGDQSAQHRGLGRKLVAEAERL
AHDEYGLSSLAILSGVGAREYYRSLGYELSAGYMCKRLA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggcgttaccccggtggcggttatgaccaaacct
ctgccgtgtcccggcaagtgcatatattgtcctacttttgctgccactccccagagctat
acacctgaatctccggctgttttgcgggctaaaagctgtgaataccaggcttacaaacag
gttgcccttcgcctgcggataatacaggatatgggtcaccctacagataaggttgagctt
atagttatgggtggtactttcctttcagcagataccgcctaccagtatggtttcattaaa
gactgctatgatgcgttgaatgggatagtggctggcagtctggaggaagctaagactata
aatgaaactgctcagcaccgctgcgtaggcttatgcattgagacccgcccggatatctgc
ggtgagaccgaaatacaacggatgatagatttcggaactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataaactggttgaacggggacatacagttgcggatgtg
gctgaggccacccgccttttgcgtgaatacggcctaaaagtgcattaccactggatgccc
ggacttcccggttcagcccctgaaaaagatctggcactttcccgcatggtgtttgaagat
ccccggttttgccctgacgggcttaagctttatcccactatggtagtggaggggactgta
cttgaggagtggtggaaagaaggcagatatacaccgtacccaagtgacatcatgaccggg
cttattgcggatattaaagctctggtgccgccttatgtgcgtatctcacgggttcttcgg
gatataccggcggtatttatcagcgcgggactcaaagactccctgagagatggtgttcgg
cagatactggaaagccgccaccagaagtgcaggtgtatacgctgtcgtgaatacggccac
cgccagcggaaaggacaaaccagtggtgaacccaccttaaggcgacttgattatcctgct
tcggagggcaacgagatattccttagctttgaggattcttccgataccctttatggtttg
ctcagattgcgtataccccgtttatccctgcctgttccggataaaaaatacggcggtaaa
ataggactggtacgtgaactgcatgtatatggcatagaactctcactgggtgaacaggga
gaccagtctgcccagcaccggggtcttggcagaaagctggtggctgaggcagaacggctt
gcccatgacgaatacggccttagctcactggcaatactaagcggtgtgggcgccagagag
tattaccgttcactcgggtatgaactttcggcagggtatatgtgtaagcgtctggcttga

DBGET integrated database retrieval system