KEGG   Dehalococcoides mccartyi GY50: GY50_0602Help
Entry
GY50_0602         CDS       T02938                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dmg  Dehalococcoides mccartyi GY50
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dmg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GY50_0602
Enzymes [BR:dmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GY50_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(552896..553882)
Genome map
AA seq 328 aa AA seqDB search
MTACRLEAIGLGAVHVDHIYTVEQILHDGECVVTESALFPGGSGANTIHGLSRLGLKCGF
IGAVGNDPDGNLLIKDFENAGIDNRYLMVKNEAQTGSVVSLSESSGRRSTYVNPGANNYL
DLSDINLEYLSQAKLVHMSTFFNQNEFALCHEIAERLAPGVLFSFSPGALFAAQGLKRLA
PILSRTNALFTNQQDIEKMTQKNYQRATDMCIRSGCEHVVVTLGESRRFQRKGKITLQTY
IRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTGFLFGLMGDKPIEECGLLGDISARF
CISKLGARSGLPDLAGLKERFGMHYFTN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactgcttgtcgtcttgaggctatcggcctgggggcggtgcatgtagaccatatatac
actgtagaacagatactccatgacggggaatgcgtagttaccgaatctgctttatttccc
ggcggttcgggggccaataccatacacgggctgtcccgtctgggattaaaatgcggtttc
ataggggcagtggggaatgaccctgatggaaacttgttaattaaggattttgaaaatgca
ggtatagataaccggtatctgatggtaaaaaacgaagcccaaacaggctctgtggtttcc
ctgagcgagtcttctggacgccgctcaacatatgtaaatcccggtgccaacaattatctt
gacctttctgatataaatctggaatacctaagtcaggctaaactggttcacatgtccacc
ttttttaaccagaacgaatttgccctttgccacgaaatagcggaacggctggcaccaggt
gtactttttagtttttcacccggagccctctttgccgcccaaggcttaaaaaggcttgca
cccattctttcccgcaccaatgccctcttcaccaaccagcaggatatagaaaaaatgacc
cagaaaaactatcagcgggctacagatatgtgtatccgcagtgggtgtgaacatgtagtg
gtaactctgggggagagccgtcgttttcagcgaaaaggcaaaataacactccagacctat
atacgggacaaagaccacgaatgccatatggagtcaaccgtaagcctccggaaagatatc
cgtaccgtagttgatacaataggtgcggcagatgcttttactaccggttttcttttcgga
ttgatgggtgacaaacctattgaagagtgcggtttgctgggtgatatttccgctcgtttt
tgtataagcaaactgggagcccgctcagggctgcctgaccttgcggggctgaaagaacgc
tttggtatgcactactttaccaactaa

DBGET integrated database retrieval system