KEGG   Desulfosporosinus meridiei: Desmer_0022Help
Entry
Desmer_0022       CDS       T02207                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desmer_0022
DNA repair and recombination proteins [BR:dmi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Desmer_0022
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desmer_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 IMS_HHH zf-CXXC
Motif
Other DBs
NCBI-ProteinID: AFQ42126
JGI: DesmerDRAFT_0022
UniProt: J7ITV6
Position
18212..18808
Genome map
AA seq 198 aa AA seqDB search
MDFLKYPQPLAELISSLSRLPGIGPKTAGRLAFYLLQQPQVSEDLAKAIVVANRDIRKCS
ICSNFTDHDPCAICKNMQRDLTALCVVEHPRDVVSLEKTGEFKGIYHVLHGVLSPMDGIG
PEQLTINQLLRRLEGIKEVVMAMNPTVEGEATALYLARLLKPMGIKVSRIAHGLPVGGDL
EYADEITIARALEGRRDL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttaaaatacccccagcctttagcggaactaattagctccttatctcgttta
cctgggattggacccaaaacagcagggaggctggctttttaccttcttcaacaaccacaa
gtttcggaggatctagcaaaggctattgttgttgcgaacagggatattcggaaatgttcg
atttgctcaaattttactgatcatgatccttgcgcaatttgtaaaaatatgcaaagagat
ctaactgctttatgtgtcgtcgagcatccaagagatgtagtatcgttagaaaaaaccggg
gaatttaaaggaatttatcatgtactccatggtgtactctctccaatggatgggattgga
ccggagcaattgacaattaatcaacttttaagacgtttagaaggaattaaggaagtcgtt
atggcaatgaatcccactgtggaaggggaagcaaccgctctgtatttggctcgattgttg
aaaccaatggggatcaaagtatcacgaatagctcacgggttacctgttggcggagactta
gaatatgcagatgaaataactattgcccgtgctctagagggcaggagagatttataa

DBGET integrated database retrieval system