KEGG   Desulfosporosinus meridiei: Desmer_0080Help
Entry
Desmer_0080       CDS       T02207                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desmer_0080
Enzymes [BR:dmi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Desmer_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77785..78999
Genome map
AA seq 404 aa AA seqDB search
MQVYGMRWVAINNLQESKIALAQIGSDPGGVAQMVGKGIGRAIKLEQVPLRVAHILKQEM
LSVGGDAAVHREVITNNIDATDVMLLGTVRQLEHLAKKVLAQPFGLKKVGHALKQLLTDL
EPAQTRSINCRGKELILGGRTLVMGILNVTPDSFSDGGKFNNLEDAVVQAGCMIDDGADI
LDIGGESTRPNYSGISAEEEWRRLEPVLKMLLERVNVPISVDTYKASVAAKALEAGAHMI
NDVWGLQKDPDMAKVVGDFHVPVIVMHNQAGTAYHHLMGDIFAFLQKSIELAESNGLERD
QIIVDPGIGFGKTTEQNLEVMARLAEFKTLGRPVLLGTSRKSMIGNTLNLPVNERLEGTL
ATSVLGIVSGVDIIRVHDVKANKRAMQMADAIVRGQRGAGYVGA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtatatggaatgcgctgggttgcgattaataatttgcaagaatctaaaatagca
ttggcacagataggatccgatccggggggagtagcccagatggttgggaagggaataggg
cgtgcgataaaactggagcaagttccgctgcgagtagcccatatactcaaacaagagatg
ctttctgtaggtggggatgctgctgtacaccgggaggttataactaataacatagatgca
acagatgtcatgttattaggtacagtgcggcaattagagcacctggcgaagaaggtgtta
gcacaaccatttggactaaaaaaggttggacatgctcttaagcaactgctaactgattta
gaaccggcccagacccgaagtatcaattgccgaggaaaggaacttattctgggggggcgt
acccttgtaatggggattttaaatgtaactccggattcattttctgatggcggtaaattc
aataacctagaagacgctgttgttcaagctgggtgtatgatagatgatggcgcagatatt
ctagatattggcggagagtcaacacgtccaaactactcgggaattagtgccgaagaggaa
tggaggcgcttagaaccggtattaaagatgctgctagaacgagtaaatgttcccatttca
gtggatacctataaggctagtgtagcagctaaagcgcttgaagcaggtgcccacatgatc
aatgatgtatggggattgcagaaagaccctgatatggctaaagtagttggtgatttccat
gtccctgttattgttatgcacaatcaagctgggacagcctatcatcatttaatgggcgat
atttttgcattcttacaaaagagcatcgagttagctgaatccaatggtctggagagggat
caaatcattgttgatccgggaatcggatttgggaaaacgacggaacaaaatcttgaggtt
atggctcgcttggcggaatttaagaccttagggcgtccggtattattgggaacttcgcgt
aaatcaatgatcggaaatacattaaacctacccgtcaatgagcgcttagaagggacgttg
gccacaagcgttttagggattgtttcgggagtagatattattcgtgttcacgacgttaag
gctaacaaaagggcaatgcaaatggccgatgcgattgtaagaggacagagaggagctggc
tatgtcggagcatga

DBGET integrated database retrieval system