KEGG   Desulfosporosinus meridiei: Desmer_0080Help
Entry
Desmer_0080       CDS       T02207                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dmi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77785..78999
Genome map
AA seq 404 aa AA seqDB search
MQVYGMRWVAINNLQESKIALAQIGSDPGGVAQMVGKGIGRAIKLEQVPLRVAHILKQEM
LSVGGDAAVHREVITNNIDATDVMLLGTVRQLEHLAKKVLAQPFGLKKVGHALKQLLTDL
EPAQTRSINCRGKELILGGRTLVMGILNVTPDSFSDGGKFNNLEDAVVQAGCMIDDGADI
LDIGGESTRPNYSGISAEEEWRRLEPVLKMLLERVNVPISVDTYKASVAAKALEAGAHMI
NDVWGLQKDPDMAKVVGDFHVPVIVMHNQAGTAYHHLMGDIFAFLQKSIELAESNGLERD
QIIVDPGIGFGKTTEQNLEVMARLAEFKTLGRPVLLGTSRKSMIGNTLNLPVNERLEGTL
ATSVLGIVSGVDIIRVHDVKANKRAMQMADAIVRGQRGAGYVGA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtatatggaatgcgctgggttgcgattaataatttgcaagaatctaaaatagca
ttggcacagataggatccgatccggggggagtagcccagatggttgggaagggaataggg
cgtgcgataaaactggagcaagttccgctgcgagtagcccatatactcaaacaagagatg
ctttctgtaggtggggatgctgctgtacaccgggaggttataactaataacatagatgca
acagatgtcatgttattaggtacagtgcggcaattagagcacctggcgaagaaggtgtta
gcacaaccatttggactaaaaaaggttggacatgctcttaagcaactgctaactgattta
gaaccggcccagacccgaagtatcaattgccgaggaaaggaacttattctgggggggcgt
acccttgtaatggggattttaaatgtaactccggattcattttctgatggcggtaaattc
aataacctagaagacgctgttgttcaagctgggtgtatgatagatgatggcgcagatatt
ctagatattggcggagagtcaacacgtccaaactactcgggaattagtgccgaagaggaa
tggaggcgcttagaaccggtattaaagatgctgctagaacgagtaaatgttcccatttca
gtggatacctataaggctagtgtagcagctaaagcgcttgaagcaggtgcccacatgatc
aatgatgtatggggattgcagaaagaccctgatatggctaaagtagttggtgatttccat
gtccctgttattgttatgcacaatcaagctgggacagcctatcatcatttaatgggcgat
atttttgcattcttacaaaagagcatcgagttagctgaatccaatggtctggagagggat
caaatcattgttgatccgggaatcggatttgggaaaacgacggaacaaaatcttgaggtt
atggctcgcttggcggaatttaagaccttagggcgtccggtattattgggaacttcgcgt
aaatcaatgatcggaaatacattaaacctacccgtcaatgagcgcttagaagggacgttg
gccacaagcgttttagggattgtttcgggagtagatattattcgtgttcacgacgttaag
gctaacaaaagggcaatgcaaatggccgatgcgattgtaagaggacagagaggagctggc
tatgtcggagcatga

DBGET integrated database retrieval system