KEGG   Desulfosporosinus meridiei: Desmer_0194Help
Entry
Desmer_0194       CDS       T02207                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00020  Citrate cycle (TCA cycle)
dmi00640  Propanoate metabolism
dmi00660  C5-Branched dibasic acid metabolism
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01120  Microbial metabolism in diverse environments
dmi01130  Biosynthesis of antibiotics
dmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desmer_0194
   00640 Propanoate metabolism
    Desmer_0194
   00660 C5-Branched dibasic acid metabolism
    Desmer_0194
Enzymes [BR:dmi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desmer_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 GARS_A CPSase_L_D2 Citrate_bind ATP-grasp GYD Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: AFQ42259
JGI: DesmerDRAFT_0194
UniProt: J7IQ19
Position
188927..190204
Genome map
AA seq 425 aa AA seqDB search
MAKFLEFQGKEWLRKSGLPVPQGRVASTPEEAKKIAEEIGKAVAVKGQVQAGGRGKAGIV
KLVNTPDEAAAAAAEILAKSIGGNPILQVLVEEKLDIQKEYYCSFVINGAREARSPMLMF
SAEGGMDIESVPEELLFKINIDPINGLQTYDAVDVCARAGIPAQDLSKFASFLSKLSQTY
KKLDCQTLEINPFVMTGSGNLVCADCKMEIDNSSVGRHPEFGIKIARDLPGAPTELDLIG
WSIEETDARGTGFLMNMGYDEVSPGYIGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVGSKIYRVAKCVLSQPNIDGYLLGGFMMANQEQWHHAHAIVKVLREILPTQKPGLPCVL
LLCGNREDESLEILRDGLADLMTPDGPGKRIEIYGKQYVTDTKFIGQRLLALSQEYRAEK
ESQGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttctagagttccagggaaaagaatggcttagaaaatcaggactaccagta
ccccaaggtcgggtagcgtccactccggaagaggccaagaagattgccgaggagataggc
aaagccgttgcagtcaaaggccaagtacaggctggcggacgtggtaaagcaggaatcgtt
aaattagtaaatactcctgatgaggcagcagctgctgcagcagaaattcttgctaaaagc
atcggaggaaatcctattttacaagttcttgttgaggaaaaactggatatccaaaaagag
tattattgttccttcgtaatcaatggtgcaagagaagcacgttctcctatgctaatgttt
agtgctgagggcggaatggacattgaaagcgttcccgaagaattgctcttcaaaattaac
attgatccgattaatggacttcaaacttatgatgcagtagatgtatgtgcacgggcaggt
attcctgctcaggatctaagtaagtttgccagttttctatcaaagctatcccaaacctat
aaaaagttagattgccaaaccctggagatcaatccctttgtaatgacaggcagcggtaat
ttagtctgtgccgattgcaaaatggagattgataacagctcagttggacgtcatccggaa
ttcggcatcaagattgcccgggatctgcccggtgcgcctacggagttagaccttattggc
tggagcatcgaagaaaccgatgcccgcggaaccggcttcctcatgaatatgggttatgac
gaagtaagtcccggttatatcggctatcaccctattggtggtggttcagcaatgatgggt
ttagatgctttgaatcaggtaggccttaaaccagccaactatgctgacaccagtggaaac
ccagtaggttcgaaaatttatcgggttgctaagtgtgttctttctcagcccaacattgat
ggttatctgctcggcggatttatgatggccaaccaagagcaatggcatcatgcccatgct
atcgttaaagtactcagggagattctaccgactcaaaaaccagggctgccatgcgtattg
ctgctctgcgggaacagggaagatgaatcactggaaattttaagagatggtctcgctgat
cttatgactccagatggtccgggtaagagaatcgagatttatggtaaacagtatgtaacg
gatacgaaattcattggacaaagactcttagctcttagtcaagaatacagagctgaaaaa
gaatcgcaaggaaagtag

DBGET integrated database retrieval system