KEGG   Desulfosporosinus meridiei: Desmer_0222Help
Entry
Desmer_0222       CDS       T02207                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desmer_0222
Enzymes [BR:dmi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Desmer_0222
Amino acid related enzymes [BR:dmi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Desmer_0222
Transfer RNA biogenesis [BR:dmi03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desmer_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215213..216676
Genome map
AA seq 487 aa AA seqDB search
MEIRVRFAPSPTGPLHIGGARSALFNYLWARKNKGTFIVRSEDTDLERSSRESEHNILQA
LRWLDIQWNEGIEVGGEHGPYRQTDRLELYKDYQEKLLANGHAYYCYCTEEELEQERQSL
IAKGETPRYLGKCRNLSAEQREAFEIEGRKPVIRFRVPEGQAIHISDKVRGDVVFDSNGI
GDYVIVKSDGIPTYNFAVVVDDITMSITHVIRGEEHLSNTPRQVMIYQALGSPAPEFAHI
SLILNTEGGKMSKRDGDTAVIDYQQKGYLPEAIVNFIALLGWAPTGEEEFYTLDELAKEF
SLDRVSKSPAVFDRHKLDYINSHYIKASSPERLAELAMPHLEELGMLPQDQRSVEQQQWL
VSFIKAIAEKISYLAEVKDYIHYFHGDTPLEPQSDALEVLKGEQVPSVLAMFKEKLQGAE
MLSAETVKVILKQMTKELKLGGKFVYMPVRIALTGQMHGPELYDIIPLLGLKNVLGRIGY
TEEHYLG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgtgttcggtttgcaccaagtccaacagggccgcttcatataggaggagca
agatcggctttatttaattatttatgggctcgcaagaataagggtacatttattgtacga
agtgaagatactgatttagagcgttctagcagggaatcagaacataacattttgcaagca
ctaagatggttagatattcaatggaatgaaggaattgaagttggtggggaacatggccct
tatcggcaaactgaccgtttagagctttataaagattatcaggaaaagctgcttgctaat
gggcatgcctactactgttactgtactgaagaagagctggaacaggaaagacagtctcta
attgctaaaggagagactccacgctatttagggaagtgcagaaatttgtctgcagagcaa
cgtgaggcgtttgaaattgagggccgaaagcccgttatacgctttcgcgtgccagaggga
caggcaattcatatttctgacaaggtacgtggggatgttgtatttgatagcaacggtatt
ggagattacgttattgtaaaatcagatggaattcctacatataattttgcagttgttgtt
gacgatattactatgtcaataacccatgtaattcggggggaagaacatctttctaatact
cctcgccaggttatgatttatcaggcattaggatctccagcccctgaatttgctcacatt
tctctgattcttaatacagagggaggaaagatgagtaagcgggatggggatactgcagtc
atagattatcagcagaaagggtatctcccggaagctattgttaattttattgctctactt
ggttgggcacctacaggagaagaagaattttatacccttgatgaattggcaaaggaattt
tcgttagatcgagtttccaagagccctgctgtctttgatcgacacaagctggattatatc
aactcacattatattaaagcgtcctcaccggaacggctagcggaacttgctatgcctcat
cttgaagaattaggcatgcttccccaggatcaaagatccgttgagcagcagcaatggctg
gtaagctttattaaggctattgcagagaaaatatcttatttggctgaagtgaaggattat
attcattattttcatggcgatactccacttgaaccgcagagtgatgccttggaagtgtta
aaaggcgaacaggtcccaagtgttctggctatgttcaaagaaaaattgcagggagcagag
atgctttccgctgagacggtaaaagttattctgaaacaaatgactaaagaattaaaactt
ggtggtaaatttgtatacatgccagttcggatagcattaacaggacagatgcacgggccg
gaattgtatgatattatccccttgctggggctcaagaatgttttggggcgcatcgggtat
acagaggagcattatttagggtag

DBGET integrated database retrieval system